Identifiers and Description

Gene Model Identifier

Contig21034.0.g40

Standard Name

RPL34

Aliases

Contig21034_0_g40

Description

Ribosomal protein L34e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001496302.9990241513684e-2160S ribosomal protein L34, put
ative
SGDYIL052C9.997019043202629e-21RPL34B SGDID:S000001314, Chr I
X from 256554-256226,2570...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21034.0.g40(coding)
ATGTTGGAAAGAAGAGTTCATTACAGACGCCAAAACCACTACAAAACTGGCTCTAACAAG
TACAAGATTGTCAAGACCCCAGGTGGCAAGCTCACAATTCACTACTTGAAGAGAAGCGCC
GGTCAAAGCATGCCAGGTATTCCCAAGCTCAGATCACCAGCTCTTTCAAGACTCACCATC
ACCAAGAGAACTGTTGCCAGAGCCTACGGCGGTAAATTGTCCCACACTGAGGTTAGAGAC
AAGATCGTGAGAGCCTTCTTGATCGAAGAGGTGAAGCAAATGAAGCGCTTGATGCAACAA
AAGGACAAATCCTCCAAGAAATCCAAGAAGAACAAGTCAAAGGGAAAGAAGAAGTGA


>Contig21034.0.g40(protein)
MLERRVHYRRQNHYKTGSNKYKIVKTPGGKLTIHYLKRSAGQSMPGIPKLRSPALSRLTI
TKRTVARAYGGKLSHTEVRDKIVRAFLIEEVKQMKRLMQQKDKSSKKSKKNKSKGKKK