Identifiers and Description

Gene Model Identifier

Contig20794.0.g55

Standard Name

RPL32

Aliases

Contig20794_0_g55

Description

Ribosomal protein L32

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000851804.000352986427571e-28Ribosomal protein L32 containi
ng protein
SGDYBL092W5.9971655715910366e-21RPL32 SGDID:S000000188, Chr II
from 45978-46370, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20794.0.g55(coding)
ATGATGCCCAGCATCGGTTAAGCCTCAAACAAAAAGACCAGACACATCTTGCCCAATGGA
TTCAGAAAGTTGCTCATCCGTAACGAAAAAGATATTGAACTCCTCCTTATGAACAACAGA
ACCTACTGCGCTGAAATCGCCCAGGGTATCTCAGCCAAGAACAGAAAGACCATCGTTCAA
AGAGCTAAGGAACTCAACGTTAGACTCACCAACGGTACAGGCAAGCTCAAGAAGACTACT
GCCGAATGA


>Contig20794.0.g55(protein)
MMPSIGQASNKKTRHILPNGFRKLLIRNEKDIELLLMNNRTYCAEIAQGISAKNRKTIVQ
RAKELNVRLTNGTGKLKKTTAE