Identifiers and Description

Gene Model Identifier

Contig22530.0.g91

Standard Name

RPL31

Aliases

Contig22530_0_g91

Description

Ribosomal protein L31e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009430106.000354955737408e-3960S ribosomal protein L31, put
ative
SGDYLR406C2.0003218023735366e-33RPL31B SGDID:S000004398, Chr X
II from 931349-931065,931...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22530.0.g91(coding)
ATGCCAAGAGTTAGAGATGGCAAGAAGAAGGAAGTCGTTCCAGTTACCAGAGATTACACC
ATCAATCTCAGTTCAAGACTCCACGGAATCCAGTTCAAGAAGAGAGCTCCAAGAGCCATC
AGAGAAATCAGAAAGTTCGCCGTGGCTGAGATGTTCACTAAGGATGTGAGAGTTGACACA
AGCTTAAACAGATTCTTGTGGAGTCAAGGCATCAGAAACGTTCCAAGAAAGGTGCGTGTA
AGAATCTCAAGAAAGAAGAATGAGGATGAGGATGCCAAGGAGAAGTTCTACAGCTTGGTT
CAGCACTTGCAAGTCGAGACTTTTGAGAAACTCTAGACCGAAAAGGCCTGA


>Contig22530.0.g91(protein)
MPRVRDGKKKEVVPVTRDYTINLSSRLHGIQFKKRAPRAIREIRKFAVAEMFTKDVRVDT
SLNRFLWSQGIRNVPRKVRVRISRKKNEDEDAKEKFYSLVQHLQVETFEKLQTEKA