Identifiers and Description

Gene Model Identifier

Contig2102.0.g59

Standard Name

RPL30

Aliases

Contig2102_0_g59

Description

Ribosomal protein L7Ae/L30e/S12e/Gadd45 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam01248 ) Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
  • ( pfam13344 ) Haloacid dehalogenase-like hydrolase
  • ( pfam01759 ) UNC-6/NTR/C345C module

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGL030W4.999456391042964e-45RPL30 SGDID:S000002998, Chr VI
I from 439091-439093,4393...
T. thermophilaTTHERM_004462801.000159011384939e-43Ribosomal protein L7Ae contain
ing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2102.0.g59(coding)
ATGAGCAGCGCCGCCCAAAAGAAGTCACAAGACAACATGAACTCCAAGCTTACTTTAGTC
ATTAAGTCAGGCAAATATAGACTTGGATACAAGTCAACCATCAAGACATTGAGACAAGGA
CAAGCCAAACTCATCTTGATTTCAAACAACTGCCCAGCCATTAGAAGAACTGAGCTTGAG
TACTACGCTATGCTCTCAAAGTCTCAAGTCCACCATTTCGACGGTAACAACATCGAACTC
GGTACCGCTTGCGCTAGACTCCACAGAGTTGCTGTTATGGCCATTACTGAAGCCGGAGAT
TCTGACATCCTCGAATCAGTATGA


>Contig2102.0.g59(protein)
MSSAAQKKSQDNMNSKLTLVIKSGKYRLGYKSTIKTLRQGQAKLILISNNCPAIRRTELE
YYAMLSKSQVHHFDGNNIELGTACARLHRVAVMAITEAGDSDILESV