Identifiers and Description

Gene Model Identifier

Contig22302.0.g104

Standard Name

RPL29

Aliases

Contig22302_0_g104

Description

Ribosomal L29e protein family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYFR032C-A 168.6

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22302.0.g104(coding)
ATGGCAAAGAGTAAGAACCATACAAACCACAATCAGAACAAAAAGGCTCACAAAAACGGC
ATCCAAAAGCCAAAGAGACAAAGATACGCATCTCTCGCCGGAGTCGACCCCAAGTTCCTC
AGAAACAGACGTAGAGCAATTAAGCATATGGTCGAGAGTAGAAGAGCAAAGGTTGCTGCC
CAGTGA


>Contig22302.0.g104(protein)
MAKSKNHTNHNQNKKAHKNGIQKPKRQRYASLAGVDPKFLRNRRRAIKHMVESRRAKVAA
Q