Identifiers and Description

Gene Model Identifier

Contig455.1.g23

Standard Name

RPL28

Aliases

Contig455_1_g23

Description

Ribosomal L28e protein family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004871400.000050024383570459175hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig455.1.g23(coding)
ATGGTAAAGCTTCCCAACAGTGTATTGTGGCAATTGACAAAGAAGAACAACTCTTTCTTG
GTTAAGTTCAACGGTCAGTAATTCACACACGATCCCCTCAACCTCACCGGGTTCCACAAT
GCCTCTCAATCAGGTCTCAGCAACAACCAAGCTGTTGGTGTTCAAGTCGCTAAGGTCAGC
ACAAAGAAGGGTAAGGGCAAGAAGGCCGAGTTCTCACTCCTTAACAGACACAAATCCCAC
AACAAGATCGCCAAGGCCAAGAAGTCATCAACCAGTGGTGCCGTCTACTCAGCTCAACCA
GTCAGAAGAGGCGTCAACAGAATCGCAAAAGTTGTCAAGAACCTCACTCACATCTCAGAG
AGAACCAGAACCCTTGCTCTCAAGAGAGTGCAAAGACTTCATGCTTCTGCCAGATCCCAC
GTCAAGGGTACCGCCGCCAAGAAGGAGGAGAAGAAATGA


>Contig455.1.g23(protein)
MVKLPNSVLWQLTKKNNSFLVKFNGQQFTHDPLNLTGFHNASQSGLSNNQAVGVQVAKVS
TKKGKGKKAEFSLLNRHKSHNKIAKAKKSSTSGAVYSAQPVRRGVNRIAKVVKNLTHISE
RTRTLALKRVQRLHASARSHVKGTAAKKEEKK