Identifiers and Description

Gene Model Identifier

Contig15154.0.g20

Standard Name

RPL27A

Aliases

Contig15154_0_g20

Description

Ribosomal protein L18e/L15

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGL103W7.000176714425793e-58RPL28 SGDID:S000003071, Chr VI
I from 310967-311015,3115...
T. thermophilaTTHERM_004883404.000223764421475e-57ribosomal protein L15 containi
ng protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15154.0.g20(coding)
ATGACTGCAGCATTGAAAAAGACAAGAAAGCTAAGAGGTCACGTTTCCGCCGGTCACGGT
AGAGTTGGAAAGCACAGAAAGCATCCTCATGGTAGAGGTAAAGCTGGTGGTATGCATCAC
ATGAGAATCAACTTCAACAAATACCATCCAGGATACTTCGGAAAGAAAGGTATGAGACAG
TTCCATTTGTTGAGAAACCATCAACATCAACCAACTGTTAATCTCGACAAGCTCTGGGCC
ATCGTCTCTGAGGAAACCAGAAAGAAGGCCGCTGCCAGCAAGGACAAGGCACCCGTAATT
GATGTTACCAAAGCCGGTTTCTTCAAGGTCCTCGGCAAAGGAGTTCTCCCCAAGATTCCA
GTCATCGTCAAGGCCAAGCTCTTCACCAAGCTCGCTGAGAAGAGAATTAAGGAAGCTGGT
GGTGTCTGCGTACTCACTGCTTGA


>Contig15154.0.g20(protein)
MTAALKKTRKLRGHVSAGHGRVGKHRKHPHGRGKAGGMHHMRINFNKYHPGYFGKKGMRQ
FHLLRNHQHQPTVNLDKLWAIVSEETRKKAAASKDKAPVIDVTKAGFFKVLGKGVLPKIP
VIVKAKLFTKLAEKRIKEAGGVCVLTA