Identifiers and Description

Gene Model Identifier

Contig10169.0.g99

Standard Name

RPL27

Aliases

Contig10169_0_g99

Description

Ribosomal L27e protein family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYHR010W9.999888128184441e-42RPL27A SGDID:S000001052, Chr V
III from 126521-126551,12...
T. thermophilaTTHERM_007809601.9991517704232713e-32hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10169.0.g99(coding)
ATGGGTAAAATTATGAAACCAGGCAGAGTAGTCATTGTCCTCGCTGGAAGACATGCTGGA
AAGAAAGCTATCATTGTGAGACAGCACGATGACGGAAAGAAAGACAAGAAATTCGCTCAC
GCTTTAATCGCTGGTATTGAGAGAAACCCATTGAGGGTCACCGCTAGAATGAGCCAAAAG
AAAATCGAGAGAAGAACCAAGGTTAAGCCTTTCGTTAAGCTCGTCAACTACAACCATCTC
ATGCCCACAAGATACTTGGTTGCCACAGAAATCGACCTTAAGACCGTTGTGTCTGAGGAT
AAGCTAGCAAACAAAGAGTCCAGAAAGCAAATGAAGAGAGAGGTCAGAAAGCTTTTCCAA
GAGAAATACAATAACCCCGCACCCAAGTCAGAGAAGACCAACCACGTCGGCTTCTTCTTC
AAGAAACTCAGATTCTGA


>Contig10169.0.g99(protein)
MGKIMKPGRVVIVLAGRHAGKKAIIVRQHDDGKKDKKFAHALIAGIERNPLRVTARMSQK
KIERRTKVKPFVKLVNYNHLMPTRYLVATEIDLKTVVSEDKLANKESRKQMKREVRKLFQ
EKYNNPAPKSEKTNHVGFFFKKLRF