Identifiers and Description

Gene Model Identifier

Contig1434.1.g123

Standard Name

RPL25

Aliases

Contig1434_1_g123

Description

Ribosomal protein L23

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00276 ) Ribosomal protein L23
  • ( pfam03939 ) Ribosomal protein L23, N-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOL127W8.003017249547689e-39RPL25 SGDID:S000005487, Chr XV
from 80348-80360,80775-8...
T. thermophilaTTHERM_001349402.0003218023735366e-33ribosomal protein L23 containi
ng protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1434.1.g123(coding)
ATGAGAGTGTAAGACTTGTCATCATTATTCAATTTCATAACCATTTTTTCATCTTACCCT
CATTTGCGCAAACTCACATACGATGTTTTATAGTCTCAACCAAAGGCCGCAGCATCAACA
GTGAAGAAGGGCACCCACGCCATTAGAAAGCACAAAGTGTGGAGCAACACCACCTTCAGA
AGACCCAAGACCTTGGCTCTTACCCGTAAACCCAAGTATTCAAGAAAGAGCGTTCAAAAG
GAACAAACCTGGGACAAGTACGCCATCATCAAGTACCCAATCAGCACTGAGAGCGCCATC
AAGACCATTGAAGACAACAATACATTGGTGTTCATCGTTGACAGAAGAGCCAACAAGCCA
ATGATCAAGAAGGCCTGCAACGACCTCTATAACATCAAGGTTTCAAGAGTCAACACCCTC
GTTAGACCAGACGGTCTCAAGAAGGCTTACGTCGTGCTTTCACCCGAGCAAGACGCCCTC
GACATCGCCAACAAAATCGGAATTATGTGA


>Contig1434.1.g123(protein)
MRVQDLSSLFNFITIFSSYPHLRKLTYDVLQSQPKAAASTVKKGTHAIRKHKVWSNTTFR
RPKTLALTRKPKYSRKSVQKEQTWDKYAIIKYPISTESAIKTIEDNNTLVFIVDRRANKP
MIKKACNDLYNIKVSRVNTLVRPDGLKKAYVVLSPEQDALDIANKIGIM