Identifiers and Description

Gene Model Identifier

Contig22478.0.g91

Standard Name

RPL24

Aliases

Contig22478_0_g91

Description

Ribosomal protein L24e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004766407.001594317853847e-31Ribosomal protein L24e contain
ing protein
SGDYGR148C5.998186291993296e-23RPL24B SGDID:S000003380, Chr V
II from 787779-787312, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22478.0.g91(coding)
ATGGTGATTAAAACAGATCCCTGTTCATTCTCAGAGTACAGAATCTACCCTGGTAGAGGT
CGTAAATTCGCTGCCAAGGACGGTAAGGTGTACTACTTCTTCAGCACCAAGGTTATGTCT
CTCTTCCATCAACGCAAGAAGGCTGTCAAGTTGACATGGACCCAAGCATGGAGACGCTTC
AATAAGAAAATCAAGGTCGACGAAATCTCCAAGCGCAGAACAAAGAAGACCACCAGAGTC
CAAAAAGCCATCGTCGGTTTGAGTTTGGACGAAATCAAGAGAAGAAGAGCTGAAAAGCCT
GAGGACAAGGACAAGAAACTCGAGGCTGCCAAGAAGGAAGCCAAGCAGAGACAACAGAAG
AAGGTCGAAGCCAAGAAGCAAGAGAAGGCCAAGAAAACTGTCCAGCAAAAAGCTGCCCCC
GCTCAAAAGAATGTCCAAGCCCCCAAGAAGGGTCAAGCCAGCGGAAAGGGAAAGAAATGA


>Contig22478.0.g91(protein)
MVIKTDPCSFSEYRIYPGRGRKFAAKDGKVYYFFSTKVMSLFHQRKKAVKLTWTQAWRRF
NKKIKVDEISKRRTKKTTRVQKAIVGLSLDEIKRRRAEKPEDKDKKLEAAKKEAKQRQQK
KVEAKKQEKAKKTVQQKAAPAQKNVQAPKKGQASGKGKK