Identifiers and Description

Gene Model Identifier

Contig861.1.g24

Standard Name

RPL23

Aliases

Contig861_1_g24

Description

Ribosomal protein L14p/L23e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYER117W1.999618694399617e-70RPL23B SGDID:S000000919, Chr V
from 396769-396810,39728...
T. thermophilaTTHERM_002971409.997652352281279e-57Ribosomal protein L14p/L23e co
ntaining protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig861.1.g24(coding)
ATGAGAAGAAGTGGAAGAAGTGGAACTAAACTGAAGATTTCTTGCGGTCTCCCAACTGGT
GCCGTCATGAACTGCGCTGATAACACTGGAGCCAAGAACTTGTTCTGTATTTCAGTCACT
GCCACCGGTGCTAGACTTAACAGATTCCCCAAGGGTTCAGTAGGCGATATGTTCATTGCC
TCAGTCAAGAAGGGTAAGCCCGATCTAAGAAAGAAAGTCATGCCAGCAGTTATCATCAGG
CAACGCAAAGCTTACCGTAGAAGAGAGGGTTACTATCTCTACTTTGAGGATAACGCTGGA
GTTATTGTGAATCCAAAGGGAGAGATGAAGGGATCTGCTGTCACTGGCCCAGTCGCCAAG
GAATGCGCAGAACTCTGGCCAAGAATCGCTGCCAACTCTGGTTCAATCGTCTGA


>Contig861.1.g24(protein)
MRRSGRSGTKLKISCGLPTGAVMNCADNTGAKNLFCISVTATGARLNRFPKGSVGDMFIA
SVKKGKPDLRKKVMPAVIIRQRKAYRRREGYYLYFEDNAGVIVNPKGEMKGSAVTGPVAK
ECAELWPRIAANSGSIV