Identifiers and Description

Gene Model Identifier

Contig20556.0.g59

Standard Name

RPL22

Aliases

Contig20556_0_g59

Description

Ribosomal L22e protein family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002272705.000201715856339e-35ribosomal protein L22
SGDYLR061W0.0000000000010000211161514907RPL22A SGDID:S000004051, Chr X
II from 263194-263205,263...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20556.0.g59(coding)
ATGGGCAAGCAAATCTTTAAGAAGGGTCACAAGCAGGCAAAGAAGATCAATTTGAAGTTC
CAGATCAACTGCAAGCTCCCAATCGAGGACAACGTTATTGTGCTCAACGACTTCGAAAAC
TTCCTCAAGCAAAAGATAAAGGTAGAGGGCAAGGCCGGCAATCTCGGTAGCGCAGTCAGC
GTCTCAAAAGACTCCTCCAACATCATTGTGCAAGCTAGCATTCCACTTAGCAAGAGATAT
CTCAAGTACTTAACTAAGAAGTACCTCAAGAAGCAAGACCTTAAGGAATATCTCAGAGTT
GTTGCCACCAACAAGAACCAATACGAACTCAGATACTTCAACATCTAGAGCGATGAGGCA
GCTGAATGA


>Contig20556.0.g59(protein)
MGKQIFKKGHKQAKKINLKFQINCKLPIEDNVIVLNDFENFLKQKIKVEGKAGNLGSAVS
VSKDSSNIIVQASIPLSKRYLKYLTKKYLKKQDLKEYLRVVATNKNQYELRYFNIQSDEA
AE