Identifiers and Description

Gene Model Identifier

Contig1175.1.g46

Standard Name

RPL21

Aliases

Contig1175_1_g46

Description

Ribosomal protein L21e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR191W8.996537154595168e-51RPL21A SGDID:S000000395, Chr I
I from 606270-606280,6066...
T. thermophilaTTHERM_001285502.0008536325002377e-4260S ribosomal protein L21, put
ative

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1175.1.g46(coding)
ATGCCTCACGCCCACGGTTATCGTGCCAGAACTAGACATTTGTTCTCTAAGTCATTCAGA
CACCACGGACCCGTCCACCTATCAAAAATCTTGGAAGTCTACAAGAAGGGTGACTTCGTT
GATGTTATTGCTGATGGTAGCATCCACAAGGGTATGCCACACAAATTCTACCATGGAAAG
ACTGGCAGAGTCTTCGATGTGAATCAACATGCCGTTGGTGTTGTCGTCAACAAACAAGTT
AGAGGATAAATCATTCCCAAGAGAATTCACGTGAGAATCGAGCACGTACGCAAGAGTGAG
TGCAGAGAGGCTTTCAAGAGAAGAGTCAGATAGAACGATGCCCTCAAGAGAGAAGCTAAG
CTCAAAGGATTGAAGGTCTACACTAAGAGAATCAACGTCCAACCAAGAGATGCTCACCTC
ATTGAAACCTCAAAGACCTCCGTCGAGTTCATGAATCCCTTCAAGCACAGAGACTTGTTC
TGA


>Contig1175.1.g46(protein)
MPHAHGYRARTRHLFSKSFRHHGPVHLSKILEVYKKGDFVDVIADGSIHKGMPHKFYHGK
TGRVFDVNQHAVGVVVNKQVRGQIIPKRIHVRIEHVRKSECREAFKRRVRQNDALKREAK
LKGLKVYTKRINVQPRDAHLIETSKTSVEFMNPFKHRDLF