Identifiers and Description

Gene Model Identifier

Contig22564.0.g70

Standard Name

RPL19

Aliases

Contig22564_0_g70

Description

Ribosomal protein L19e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01280 ) Ribosomal protein L19e
  • ( pfam00485 ) Phosphoribulokinase / Uridine kinase family
  • ( pfam01673 ) Herpesvirus putative major envelope glycoprotein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004445109.001321650308988e-69Ribosomal protein L19e contain
ing protein
SGDYBR084C-A 1171

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22564.0.g70(coding)
ATGGCATTCCTTAGATTACAAAAGAGATTAGCTGCTTCCGTCCTTAAGTGCGGTTAAAAG
AGAGTCTGGATCGACCCCAACGAAACCAGTGAAGTCGCTCTTGCCAACTCAAGAAAGAAC
ATCAGAAAGCTCTACAAGGATGGTCTCATCATGAGAAGACAAGTCCACATGCACTCTACC
TCAAGAGTCAAGAGATTCCACGAAGCCAAAAGAAAGGGTAGACACACAGGTCACGGTAAA
AGAAGAGGTACCAAGGACGCAAGAATGCCACAAAAGGTCTTATGGATGAGAAGACAAAGA
GTCCTCAGAAGACTTCTTAGAAAATATAGAGAAGCCAAGAAGATCTCCAAGGACATCTAC
AACCACTTCTATTTAGCCTCAAAGGGTAACCAATTCAAGAACAAGTCAGTTTTGATCGAA
TCCATCCACAAGATGAAGCAAGAAAAGATCAGAGAAAAGCAACTCGAAGAGCAAAAGGAG
GCAAGAAGACAAAAGAACAACGTCAGAAAGGAGAAGAGAATCGCCAAGAAACTCGAACAA
CTCGGTGGTGCTCCAGTCAAGAAGGTTGAAGACAAGCCAGTCGAAGCCGTCAAGCAAGAG
ACCAAGAAGGCCGCTGCTGCTCCAGCCAAGAAGGATGCCGCTCCCAAGCAAGAATAAAAG
CCCGCTGCCAAGGTAGAGAAGAAGGCTGCTGCCCCCGCTAAGGATCAAGCCAAGAAGGGA
GGCAAGAAATGA


>Contig22564.0.g70(protein)
MAFLRLQKRLAASVLKCGQKRVWIDPNETSEVALANSRKNIRKLYKDGLIMRRQVHMHST
SRVKRFHEAKRKGRHTGHGKRRGTKDARMPQKVLWMRRQRVLRRLLRKYREAKKISKDIY
NHFYLASKGNQFKNKSVLIESIHKMKQEKIREKQLEEQKEARRQKNNVRKEKRIAKKLEQ
LGGAPVKKVEDKPVEAVKQETKKAAAAPAKKDAAPKQEQKPAAKVEKKAAAPAKDQAKKG
GKK