Identifiers and Description

Gene Model Identifier

Contig16734.0.g67

Standard Name

RPL18a

Aliases

Contig16734_0_g67

Description

Ribosomal L18ae/LX protein domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01775 ) Ribosomal L18ae/LX protein domain
  • ( pfam04919 ) Protein of unknown function, DUF655

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004766703.998181939598921e-51Ribosomal L18ae protein family
protein
SGDYOR312C1.9991939848149086e-44RPL20B SGDID:S000005839, Chr X
V from 900767-900250,9011...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16734.0.g67(coding)
ATGGTTAAAGGTGTAGGCGTTGAGTCAATGCAATCAAAGGTCAGACAGTTTTTCGTGATC
GGAAGAGGCCTCCCAAGTGAGAAGAACCCAAATCCCACTTTGTACAGAATGAGAGTATTC
GCTAAGAACAGTGTCCTCGCAAAGTCTAAGTTCTGGTACCACATGAAGAGACAACACAAA
GTCAGAAAGATTCAAGGAGAGATCGTCTCAGTCTCAGAGGTATTCGAAAAGAACCCATCC
GTTGTTAAGAACTTCGGTATTGTTCTAAGATACTTGTCAAGAACAGACCCCATTAACATG
TACAAGGAGTACAGAGACACAACCCTTGCTGGTGCCGTTTCCCAAATGTACATGGAATTG
AGCGGAAGACACAGAGCTCCCCATGAATCAGTACAAATCATTAAGACCAGCGTTGTTGAG
TCCAAGGATGTTAGAAGAGATCACACCAGAGCTTACTCAAAGGTCTCAGTTAAATTCCCC
AAGGTTCACCCAAGCAAGAGAGCCCCAGTCAAGAACCTCAAGAGCACCTTCAAGGCCTCA
AGACCCATCATCATCTGA


>Contig16734.0.g67(protein)
MVKGVGVESMQSKVRQFFVIGRGLPSEKNPNPTLYRMRVFAKNSVLAKSKFWYHMKRQHK
VRKIQGEIVSVSEVFEKNPSVVKNFGIVLRYLSRTDPINMYKEYRDTTLAGAVSQMYMEL
SGRHRAPHESVQIIKTSVVESKDVRRDHTRAYSKVSVKFPKVHPSKRAPVKNLKSTFKAS
RPIII