Identifiers and Description

Gene Model Identifier

Contig19269.0.g49

Standard Name

RPL18

Aliases

Contig19269_0_g49

Description

Ribosomal protein L18e/L15

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003382102.998990600740728e-62hypothetical protein
SGDYOL120C2.0000236365077126e-43RPL18A SGDID:S000005480, Chr X
V from 93843-93395,94402-...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19269.0.g49(coding)
ATGGGCATTGATTTGGTTAAAAGAGGTAGAATTCAATTGAGAAACAAGAAAGATTCAAAG
AGCTAGAATCTTTATCACCATCTTCTCGTCAGACTTTTCAGATTCCTCTCCAGAAGAACT
GACTCAGCTTTCGCTAGAACTGTCCTCAGAAGATTGCTTGCCTCAAGAATCAACAGACCA
CCTGTTTCACTCAGTCGTCTCGTCAGACACCTTGGCGCTAACCAAGGAAGAATCGCCGTC
GTTGTTGGCACAGTGACTGATGATCAGAGACTTCTTGAAGTTCCCAAGTTGACAGTTGCC
GCTCTCAAGGTCACCGAGACCGCTAGAGCCAGAATCATCAAGGCAGGTGGAAAGGTGCTT
ACTCTTGACCAGCTCGTTCTCCTCGCTCCAACTGGCACAAACACTTTACTCCTTAGAGGA
CCAAAGGACAGAGAAGCCAAGAAGCATTTCGGTCCCGCTCCAGGTGTCCCAGGCTCCCAC
GCCAAGCCATACGTCAGAGCAAAGGGAAAGAATTTCGAGAAGGGCAGAAGCATCTGA


>Contig19269.0.g49(protein)
MGIDLVKRGRIQLRNKKDSKSQNLYHHLLVRLFRFLSRRTDSAFARTVLRRLLASRINRP
PVSLSRLVRHLGANQGRIAVVVGTVTDDQRLLEVPKLTVAALKVTETARARIIKAGGKVL
TLDQLVLLAPTGTNTLLLRGPKDREAKKHFGPAPGVPGSHAKPYVRAKGKNFEKGRSI