Identifiers and Description

Gene Model Identifier

Contig4380.0.g50

Standard Name

RPL17a

Aliases

Contig4380_0_g50

Description

Ribosomal protein L22p/L17e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYKL180W2.9992141389250636e-57RPL17A SGDID:S000001663, Chr X
I from 109269-109577,1098...
T. thermophilaTTHERM_003398102.000555387360374e-52ribosomal protein L22 containi
ng protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4380.0.g50(coding)
ATGGTTAAGTATTCAAGACAACCAGCTGAGCCAACCAAATCCGCTAAGAGCAGAGCCGAT
GATGTGAGAGTGCATTTCAAGAACACTTACGAGACTGCCAGAGTTGTGAAAGGTATGAAG
ATCAAGAAGGCAATCAGATATATGGAAGATGTCCTCGAGCACAAGCAATGTGTTCCCTTC
AGAAGACACACCGGCCATGGAGGCAGAACTGCTCAAGCCGCCGTTCACGGAGTCACCCTC
GGTAGATATCCCGAAAAGTCAATCAGACACGTTCACTCCCTCCTCAAGAACGCCCAGGCC
AACGCTGAAGCCAAGGGTCTCGACACTGAGAAGTGCGTTGTCTCACATGTTGCTGTGAAC
AGAGCCGTCCAAGGCAGAAGAAGAACCTTCAGAGCTCACGGTAGAATCGGGCCATACCTT
TCCTCAAACTGTCACATTGAATTCATCATCACTGAAAAGGCCGAGAACGTCCAAAGAGGC
GCTGATGACAAGAACAAGGTCAGACTCACCAAGAAACAAGCCGCCAAGCAAAGACTCGCC
ATCGGAAAATGA


>Contig4380.0.g50(protein)
MVKYSRQPAEPTKSAKSRADDVRVHFKNTYETARVVKGMKIKKAIRYMEDVLEHKQCVPF
RRHTGHGGRTAQAAVHGVTLGRYPEKSIRHVHSLLKNAQANAEAKGLDTEKCVVSHVAVN
RAVQGRRRTFRAHGRIGPYLSSNCHIEFIITEKAENVQRGADDKNKVRLTKKQAAKQRLA
IGK