Identifiers and Description

Gene Model Identifier

Contig10140.0.g47

Standard Name

RPL15

Aliases

Contig10140_0_g47

Description

Ribosomal L15

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYMR121C2.9999146385131704e-95RPL15B SGDID:S000004728, Chr X
III from 510348-509734, G...
T. thermophilaTTHERM_012891107.99705442073232e-89ribosomal protein L15

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10140.0.g47(coding)
ATGGGAGCCTACAAATATCTTGAAGAATTGTGGAGAAAGAAGTAATCCGACGTCCTTAGA
TTCGTTATGAGAATGAGATCATGGGAATACAGACAACTCCCAGTCATTCACAAGGTACAC
AGACCAAGCAGACTCGACAAGGCAAGAAAGCTCGGTTACAAGGCCAAGCAAGGTTACGTG
ATCTACAGAATCAGAATCAGAAGAGGTGGCAGAAAGAAGCCAGTCTCAAAGGGTATTGTC
TACGGTAAACCAGTCAACCAAGGTATCAACCAACTCAAGCCAACCAGATCTCACAGAGCT
ATCGCTGAAGAGAGAGTTGGAAGAAGATGCGCTAACCTTAGAGTCCTCAACTCTTACTGG
GTTGGTCAAGACGGAACCTTCAAGTTCTTCGAAATCATCATGGTTGACCCCCACCACAAG
GCCATCAGAAGAGACCCAAGAATCAGCTGGATCGCCACCAACAACCACAAGCACAGAGAA
TGCAGAGGTATCACTTCAGCTGGCAAGAAGCACAGAGGTATGAACAAGAGAGGAGTCAAG
GCCACCGGCCAAAGACCATCCACCAACCAATCATGGCAAAGAAGAAACCAAATCTCTCTC
AGAAGATACAGATGA


>Contig10140.0.g47(protein)
MGAYKYLEELWRKKQSDVLRFVMRMRSWEYRQLPVIHKVHRPSRLDKARKLGYKAKQGYV
IYRIRIRRGGRKKPVSKGIVYGKPVNQGINQLKPTRSHRAIAEERVGRRCANLRVLNSYW
VGQDGTFKFFEIIMVDPHHKAIRRDPRISWIATNNHKHRECRGITSAGKKHRGMNKRGVK
ATGQRPSTNQSWQRRNQISLRRYR