Identifiers and Description

Gene Model Identifier

Contig22158.0.g5

Standard Name

RPL14b

Aliases

Contig22158_0_g5

Description

Nuclear fragile X mental retardation-interacting protein 1 (NUFIP1)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam10453 ) Nuclear fragile X mental retardation-interacting protein 1 (NUFIP1)
  • ( pfam00038 ) Intermediate filament protein

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22158.0.g5(coding)
ATGACAACTCATCATAGAAAGCCCTCACAAATCTAACAGCAAGTTAGTACTCCATTTAGA
AACATAACAGGGGCTGCAGTGAACGGGCAACAAAGAAAACGAAATCAGCCTACACTATAA
TTAAACAATGAGAACATAAATACCCAGGGATAGCAATCAACTTTCAGCTCAGTCGCTTCA
CAGCATCAAATGTCAAGTTCAAGCAAGTAAAGCCTAAACTAAAACGCCGTCCATAATTAC
AACAATAACAACAGTGCTTTTAGAAATTTCGGCAATATCACACCAGTATCTTCTTCAAGC
AAGCACTTCAATCTAATGAATGGAAATACTAACGAATCTAAATTGAAAATTAACACTTCA
AGTATCTTGGACACAGAATACTAGAAAACTATTTCCATGTTAGAAGACCAGCTCAGAATA
AAGGACAAAACTATCTCAGATTTAAATTTTAATGTTCAGGAGGCCAAATTAGAAATAGAG
TTGAAGTCAAATCAAAATGCAGATTTACAAAAGTGGCTTAGTTTAATGACTTAAAGTTTA
CAGTAGTAACTCTAAAATAATGGTTAAGAAGCACTCTCTGGGACAAGTGAAAACTTTACA
GCAGAGGGATTAATCACAAAAATAAATCAAGGTTTGCAAACGATAGACAATTTAAGGGTC
GAGAACTTCAACTTGAAGAAATAAATAGCATTTGACAAGAAACACTATGTTGATCTTAAA
AATGCCTATTTCTAAGTTAGGAAGGAATTCAAGCAAAAAGAACAAGACTTATTCTTGAGA
CACCCAGACTTAAAAGAAATACTGGGGGAAAAGCAAAATCTGCAAAACACACTTAAAGTC
TTGACTGAAGAAGTTGAATTTTTATCTAAGAAAAATGAGGGATTTTTAAAAGAGTTGAAA
CATAAAAACTTCTATGATGCGTATAAAAGATAGAGTGAAGAACTTACTAAACTAAGAGAA
GCCCATGCTTTGCTAATTAACTTAATATAAACTAAAGATATTGCTATTACTAAAAGCTCC
TAATCAAAGACTCCAAATGGAGCTTCAATTGGAAATGCACATTCCTTCGGTAGTTTACTT
TCAGGACAAAGTCCAATGAGTAACAACCACATCTTAAACTCTCTAGAAAGATAAACTATA
CCCCTAAGAAGACTCTTGTCCTGTAAGAACTCCACTTCAAATTATACAGCACACTCTTAA
CTCGCTCATGGCTCTAAGTGTAACAAAGATTCTTTTGTTTTAACTGATGAAAATGATTCA
TCCTCATTAGGAGGAGGACTACAGTTTGGAAATGAGGATTATGAGGCCATGGAGAGTGTG
TAGGTTTAAGATATCAATCAATATCTAGAAGCTGTTCTATCTAGATATAAGGGCAGTTAT
GGGGGATCAGGGATTAACTTCTTAGATTAATCTGCTAAGAATTCCAATGGAAATGACTAT
TGA


>Contig22158.0.g5(protein)
MTTHHRKPSQIQQQVSTPFRNITGAAVNGQQRKRNQPTLQLNNENINTQGQQSTFSSVAS
QHQMSSSSKQSLNQNAVHNYNNNNSAFRNFGNITPVSSSSKHFNLMNGNTNESKLKINTS
SILDTEYQKTISMLEDQLRIKDKTISDLNFNVQEAKLEIELKSNQNADLQKWLSLMTQSL
QQQLQNNGQEALSGTSENFTAEGLITKINQGLQTIDNLRVENFNLKKQIAFDKKHYVDLK
NAYFQVRKEFKQKEQDLFLRHPDLKEILGEKQNLQNTLKVLTEEVEFLSKKNEGFLKELK
HKNFYDAYKRQSEELTKLREAHALLINLIQTKDIAITKSSQSKTPNGASIGNAHSFGSLL
SGQSPMSNNHILNSLERQTIPLRRLLSCKNSTSNYTAHSQLAHGSKCNKDSFVLTDENDS
SSLGGGLQFGNEDYEAMESVQVQDINQYLEAVLSRYKGSYGGSGINFLDQSAKNSNGNDY