Identifiers and Description

Gene Model Identifier

Contig22158.0.g4

Standard Name

RPL14a

Aliases

Contig22158_0_g4

Description

Ribosomal protein L14

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006974904.999723464643358e-28hypothetical protein
SGDYKL006W1.999790113608142e-24RPL14A SGDID:S000001489, Chr X
I from 431906-432034,4324...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22158.0.g4(coding)
ATGGTTTTCAAGAACTTCGTTCAACCAGGCAGAGTCGCTTACGTAAACTTCGGAGAAGAC
TTGGGCAAAGTTGTTGTTATTGTTGACATTGCTGACGCCAACAGAGTCCTCGTCGATGGA
CCCACCACTGACTTCCCACGCGTTCTCTATCCACTCAAGAGACTCAGCCTCACCGGCCTC
AGAGTCCCAGGTGTTCTCAAGGGTGCTAGAACCGGAACTCTCACTAAACTCGCCACCGCA
TACAAGCTTAACGAGAAATGGGCCGCAACTGCATAATCAAAGAAATTCACAGTTAGAGCT
ACCAGAGCCAACTTGAGCGACTTTGACAGATTCAAGGTAATGATCAATAGAAAGAACAGA
TCATTCAAACTCAGACAACTCGCCAAGAAGATCTCAGGTGGCAAATCCAAGGTTGCCGCC
AAGGGCAAGGGCAAGAAGTGA


>Contig22158.0.g4(protein)
MVFKNFVQPGRVAYVNFGEDLGKVVVIVDIADANRVLVDGPTTDFPRVLYPLKRLSLTGL
RVPGVLKGARTGTLTKLATAYKLNEKWAATAQSKKFTVRATRANLSDFDRFKVMINRKNR
SFKLRQLAKKISGGKSKVAAKGKGKK