Identifiers and Description

Gene Model Identifier

Contig22600.0.g43

Standard Name

RPL13b

Aliases

Contig22600_0_g43

Description

Ribosomal protein L13

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007326405.000996804856152e-78ribosomal protein L13 containi
ng protein
SGDYIL133C6.002203762674495e-72RPL16A SGDID:S000001395, Chr I
X from 99095-98527,99416-...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22600.0.g43(coding)
ATGTTCGAAAAGGAGATTGTTATCGATGGCAGAGGCCACTTGGTTGGTAGACTTGCATCA
AAGGTTGCCAAGGAGCTCTTGAACGGTCAGAGAGTTGTAGTCGTCAGATGTGAGCTTCTT
TTGAGATCAGGTTCTCTCTTCAGAAACAAGCTTAAGTACCACGAATTCCTCAACAAGGCA
AATAACTCCAACCCAAGACGTGGTCAATTCCATTTCAGAGCTCCATCACGCATCTTCTGG
AGAGTCATTAGAGGTATGCTCCCACACAAAACCCCCAAGGGTGCTACTGCTCTTGGCAAA
TTGAAGGTCTTCGAGGGTATCCCATATCCTTATGATCAAAAGCGCAGAATGGTTGTTCCA
GACGCCCTTAAAGTCTTGAGATTAAAGTCTCACAGAAAGTTCACTGTTCTCGGAGAGCTC
GCTGCCCAAATCGGTTGGACCAAGAAGGGTCTCGTCGACAGACTCGAGGAGAAGAGAAAG
GTCAAGTCAGGCAAGTTCTGGGAACTCAAGCAAAAGAAACTCGGCGCAAGATCAAAGGCA
AGAAACAGCAACGAACTCAAGAAGGTCAACGAAGAGCTCGCTAAGTACGGATTCTGA


>Contig22600.0.g43(protein)
MFEKEIVIDGRGHLVGRLASKVAKELLNGQRVVVVRCELLLRSGSLFRNKLKYHEFLNKA
NNSNPRRGQFHFRAPSRIFWRVIRGMLPHKTPKGATALGKLKVFEGIPYPYDQKRRMVVP
DALKVLRLKSHRKFTVLGELAAQIGWTKKGLVDRLEEKRKVKSGKFWELKQKKLGARSKA
RNSNELKKVNEELAKYGF