Identifiers and Description

Gene Model Identifier

Contig20852.0.g28

Standard Name

RPL13a

Aliases

Contig20852_0_g28

Description

Ribosomal protein L13

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007326405.000996804856152e-78ribosomal protein L13 containi
ng protein
SGDYIL133C6.002203762674495e-72RPL16A SGDID:S000001395, Chr I
X from 99095-98527,99416-...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20852.0.g28(coding)
ATGTTCGAAAAGGAGATTGTTATCGATGGCAGAGGCCACTTGGTCGGCAGACTTGCATCA
AAGGTTGCCAAGGAGCTCTTGAACGGTCAGAGAGTTGTAGTCGTCAGATGTGAGCTTCTT
TTGAGATCAGGTTCTCTCTTCAGAAACAAGCTTAAGTACCACGAATTCCTCAACAAGGCA
AATAACTCCAACCCAAGACGTGGACAGTTCCATTTCAGAGCTCCATCACGCATCTTCTGG
AGAGTCATCAGAGGTATGCTCCCACACAAAACCCCCAAGGGTGCTACTGCTCTTGGCAAA
TTGAAGGTCTTCGAGGGTATCCCATATCCTTATGATCAAAAGCGCAGAATGGTTGTTCCA
GACGCCCTTAAAGTCTTGAGATTAAAGTCTCACAGAAAGTTCACTGTTCTCGGAGAGCTC
GCTGCCCAAATCGGTTGGACCAAGAAGGGTCTCGTCGACAGACTCGAGGAGAAGAGAAAG
GTCAAGTCAGGCAAGTTCTGGGAACTCAAGCAAAAGAAACTCGGCGCAAGATCCAAGGCA
AGAAACAGCAACGAACTCAAGAAAGTCAACGAAGAGCTCGCCAAGTACGGATTCTGA


>Contig20852.0.g28(protein)
MFEKEIVIDGRGHLVGRLASKVAKELLNGQRVVVVRCELLLRSGSLFRNKLKYHEFLNKA
NNSNPRRGQFHFRAPSRIFWRVIRGMLPHKTPKGATALGKLKVFEGIPYPYDQKRRMVVP
DALKVLRLKSHRKFTVLGELAAQIGWTKKGLVDRLEEKRKVKSGKFWELKQKKLGARSKA
RNSNELKKVNEELAKYGF