Identifiers and Description

Gene Model Identifier

Contig19511.0.g119

Standard Name

RPL11

Aliases

Contig19511_0_g119

Description

ribosomal L5P family C-terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR102C6.997568408582301e-83RPL11A SGDID:S000006306, Chr X
VI from 731748-731224, Ge...
T. thermophilaTTHERM_008293803.9997119520108244e-79hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19511.0.g119(coding)
ATGGCAGAGGTTGTTCAAAAGAAGAAGGAAAAGGTCGAGAACAAGATGAGAGACATCAGG
ATTGAGAAACTTGTACTCAACTGCTCCGTTGGAGAGAGTGGTGATAGACTCACCAAGGCT
GCTAAGGTCCTCGAGGATCTCACTGATCAAAAACCTGTCGAATCCAAGGCCAGATATACC
ATCAGAAGCTTCGGCATCAAGAGAAACGAAAAGATGGCTGTCCACGTGACTGTTAGAGGC
GATAAGGCTGAAGAACTTCTCAAGAGAGGTCTCAAGGTCAGAGAATACGAACTCAGAAAG
AGAAACTTCTCCGACGAAGGTAACTTCGGCTTTGGTATCGATGAACACATCGACTTGGGT
ATCAAGTATGATCCATCCACTGGTATCTATGGTATGGACTTCTACGTCGTCCTCGCAAGA
GCCGGCAAGAGAGTTCAAAGAAGAAAGCTCAAGAACAGAAAGTTCGGAAACTTCCAAAAG
ATCTCCAAGGAGGAATCAAAGCAATGGTTCATTGAAAAGCTCGGAGGTACCGTGCTATGA


>Contig19511.0.g119(protein)
MAEVVQKKKEKVENKMRDIRIEKLVLNCSVGESGDRLTKAAKVLEDLTDQKPVESKARYT
IRSFGIKRNEKMAVHVTVRGDKAEELLKRGLKVREYELRKRNFSDEGNFGFGIDEHIDLG
IKYDPSTGIYGMDFYVVLARAGKRVQRRKLKNRKFGNFQKISKEESKQWFIEKLGGTVL