Identifiers and Description

Gene Model Identifier

Contig10707.0.g22

Standard Name

RPL10

Aliases

Contig10707_0_g22

Description

Ribosomal protein L16p/L10e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010530003.0014466598835893e-101ribosomal protein L10.e contai
ning protein
SGDYLR075W2.9994041385173996e-93RPL10 SGDID:S000004065, Chr XI
I from 282927-283592, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10707.0.g22(coding)
ATGGGAAGAAGACCAGCTCGTTGCTATAGATACCAAAAGGGTAAGCCATACCCCAAGTCC
AGATACTGTCGTGGTGTCCCCGATGCTAAGATCAGAATGTACGATATCGGTAAAAAGAGA
GCCCGTTACGACGAATTCCCCTACTGCATCCATCTCGTCTCAGGTGAGAAGGAGCAAATT
ACTTCTGAAGCTCTTGAAGCCGCACGTATCGCTTGCAACAAGTACATGTCCAACAAGACC
GGTAAAGAAGGCTTCCACATGAGAACCAGAAAGCACCCATGGCACGTTATCAGAATCAAC
AAGATGCTTTCATGCGCTGGAGCCGATAGACTCCAGCAAGGTATGAGAGGTGCCTTCGGA
AAGCCATACGGAAAGTCTGCCAGAGTCAACATTGGTGACATTATCATTTCCATCAGAACC
ACTGCCCCCAACGTTGAACACGCTAAGGAGGCTTTGAGAAGATCTATGTTCAAGTTCCCA
GGTAGACAAAAGGTCGCTGTCAGCAGAAAGTTCGGCTTCACCAAGTTCACTAAGCAAGAG
TTCCATAGACTCGAAAGAGAGGGCAAGATTATTCCAGACGGTGTCAACGTAAAGGTGATC
ACCAACCACGGACCTCTTTCTAGACTCGCTATGTTCAAGTGA


>Contig10707.0.g22(protein)
MGRRPARCYRYQKGKPYPKSRYCRGVPDAKIRMYDIGKKRARYDEFPYCIHLVSGEKEQI
TSEALEAARIACNKYMSNKTGKEGFHMRTRKHPWHVIRINKMLSCAGADRLQQGMRGAFG
KPYGKSARVNIGDIIISIRTTAPNVEHAKEALRRSMFKFPGRQKVAVSRKFGFTKFTKQE
FHRLEREGKIIPDGVNVKVITNHGPLSRLAMFK