Identifiers and Description

Gene Model Identifier

Contig16925.0.g73

Standard Name

RPF2

Aliases

Contig16925_0_g73

Description

Transmembrane amino acid transporter protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000356301.0004249259458435e-52Brix domain containing protein
SGDYKR081C1.0000633497921574e-36RPF2 SGDID:S000001789, Chr XI
from 592540-591506, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16925.0.g73(coding)
ATGGCAAAACAAGTCGTTCACAAATCTCCAAATGGAAATGGAAGAGGTGCTGGAAACAAG
ACTGGCAAGAAGGTTGCTAAGAAGACTTTTGATGTTGGTCTTGCTTAAAAATCCAAAGAA
ATCAAGAAAGCCAAGACTCACAAGGGAAGAAAGATTATGGAAAGCAGAGCACCAAAGGTT
GTTGAAAACCAAAAGACTGCTATCATTATGAAGGGAAACAAATCTAGCAATGTAGTAAAT
CAAATCATGAAGGAGCTAAACATTCTAAGAGGTCAAGAAGAGAAATCAAGACTTTTTGTA
AGAAAATCACATGATATTCACCCATTTGAAAACCAAGGACCCCTAGAAATTTTTGCATCC
AAGCAAGACTGCAGTTTGATTATCTTCGGTAACCATTAAAAGAAGAGACCTGACAACTTG
ATCCTAGGTAGAATCTATGATAAGAGAGTATTAGATATGTTTGAATTTGGAGTCTCTAAC
TTTAAATCCATGGAAGAGTTTGCTGTTAAAGAGGTGTCTAGAGAGTTGAAACCCATTCTT
ATTTTCTAAGGAGAGCAATTCGAATTTTCAGAGAAGCATTAAAGAGCAAAGAACTTGTTT
TACGAGCTTTTTCACATGAACACCCTAGAAGAAGCAAACATTGTAGAAATGAAAAGAGCA
CTTGTTTTCACTTCAACTGATGATACTACTATTCAAGTGAGGTAATATGAAATCCCTCAA
ATCACAGAACCACAAGTAATGAAAAGTCAGCTAGATTTAGTTGAAATTGGACCTAGATTT
GACCTTAAACTTAGAAGAAATCAAGTCGCATCAATGGATTTGTACAAAATTGCTTGCAAA
AAGCCTAAGGTTCTCAATCCAGACAAGAAGAGATTCAAGAAAAACGTTTATACCACAGAG
ATTGGAGATAAGAGAGCTAAAGTCTTCATCCAACAACAAGATTTAGATATTTTAGCTACA
AGAAAATTCAAGAAATAGAAGCCACAAAAGATTCAAGCCGAAGATGATTATGGTTCTATC
TAAGATGATTGTGATTCGAATGATGGATCATTGCTGACAGGTCAATTTTCTCAGAGGAAC
TCATTAATTGGAGGAGTCAGTGACATTTCTAAGACAGATTTGTATCCGAAAACTGGGTTT
ACTCTAACTACTGCAAATATTGTCAAATCTTTCGTTGGATTGGGTATACTAGCAGCTCCT
TATGGTTTCATGGAAGTTGGGTATTTACCAGCTACGATACTAATACTAACCAATGCAACT
TTGAATTTTTATACAGTGCATTTGTAAACGAAAGCCAAGGAGCATTATGGTCGAAAAGTT
AAGACCTTCTCAGATTTAGGAGAGGCATGTTTTGGAAAATGGGGAAGAGTAGCCACAGCA
TTAAACATAGTAATTGGGCAATTCTTTTGCTGCTCTGGTTATGTCATGTTCTTTATTCAA
TAGATAGATTAAGTCATTAAATACACAACAGGAGACATGACTTCTGACAATAGATTCCTG
ATCTTTATGCTCTCATTTCTGATATTGGCTCCATTAAGTACTTTTGAGAGCATGAAATAA
GTTTCTTACATATCTATCACAGCAATTATTTCAATCTCTATAGCGCTATGCTATATTATT
TTGACTGATATAAGCGAAATAAATTATCCTAGTTTTGATAAGACACTAAACTATGTTAAT
TTATCAGGGATACCCTATTTCTTTGGAATAGCTATGTTCATGTTCGAAGGTAACGTTGTT
GCAGTAGAAATTCACAATTAGATGGAAGAAGCACCAAAAAGGTTTACTTAATCTTTGGGA
AATGCTTTGGCTATTACTGCAACTTTAATTTTGATTGTTGGTACACTTTCTTACTCTGCA
TTTGGATAATTCACTAAAAGTATCATTCTTTTGAATTTAAAGCCATCCTTAATGACCTAT
GTGGTGCAAATATTTTACTCAATCGGAATACTATGTAGTTACTGTCTGCAAATAATTCCA
ACTTTTAAAATCATGAATTTAATACCAGTTTACAAAAACATCCCTGAAAGTAGAACCTAC
CCCTGGATGAAATCTTTCCTAACAAGAATAGCAGTAGCATTTATTTGCTGCACGTTTGCC
TTAGTTATTCCAAATTTAGGCTAATTCTTGAATTTCTAAGGAGCCATAGGGGGATGTTTA
GTGACCTTCATTTTTCCTATAGCTTTTTACTTTAAGACTTTTGGAATCGATAAAATCCCA
AATAGGGAGAGGTATCTATGCTATGCAGGATTAACATATGGGACGATAGGGGGTTTGTGG
TCGGCTTATTATTCACTACATGCAATGTTTAACAAGTAGTGA


>Contig16925.0.g73(protein)
MAKQVVHKSPNGNGRGAGNKTGKKVAKKTFDVGLAQKSKEIKKAKTHKGRKIMESRAPKV
VENQKTAIIMKGNKSSNVVNQIMKELNILRGQEEKSRLFVRKSHDIHPFENQGPLEIFAS
KQDCSLIIFGNHQKKRPDNLILGRIYDKRVLDMFEFGVSNFKSMEEFAVKEVSRELKPIL
IFQGEQFEFSEKHQRAKNLFYELFHMNTLEEANIVEMKRALVFTSTDDTTIQVRQYEIPQ
ITEPQVMKSQLDLVEIGPRFDLKLRRNQVASMDLYKIACKKPKVLNPDKKRFKKNVYTTE
IGDKRAKVFIQQQDLDILATRKFKKQKPQKIQAEDDYGSIQDDCDSNDGSLLTGQFSQRN
SLIGGVSDISKTDLYPKTGFTLTTANIVKSFVGLGILAAPYGFMEVGYLPATILILTNAT
LNFYTVHLQTKAKEHYGRKVKTFSDLGEACFGKWGRVATALNIVIGQFFCCSGYVMFFIQ
QIDQVIKYTTGDMTSDNRFLIFMLSFLILAPLSTFESMKQVSYISITAIISISIALCYII
LTDISEINYPSFDKTLNYVNLSGIPYFFGIAMFMFEGNVVAVEIHNQMEEAPKRFTQSLG
NALAITATLILIVGTLSYSAFGQFTKSIILLNLKPSLMTYVVQIFYSIGILCSYCLQIIP
TFKIMNLIPVYKNIPESRTYPWMKSFLTRIAVAFICCTFALVIPNLGQFLNFQGAIGGCL
VTFIFPIAFYFKTFGIDKIPNRERYLCYAGLTYGTIGGLWSAYYSLHAMFNKQ