Identifiers and Description

Gene Model Identifier

Contig22325.0.g46

Standard Name

RPF1

Aliases

Contig22325_0_g46

Description

Brix domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYHR088W3.0014802379878627e-60RPF1 SGDID:S000001130, Chr VII
I from 281495-282382, Gen...
T. thermophilaTTHERM_001521408.003613776907505e-34Brix domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22325.0.g46(coding)
ATGGGCAAAAAGGTAAAGAAGCAATAAATCTCAATTATCAATGATGGAGATGATGAAGTC
GTCTCTAAGAAGCAGTCAAAGAAACTAGGCAAAGATAAAAACAATAGGAAAGATAAGAAG
AAAGACGATAAGAATTCTAAAAAGCAGAAAAAAGTCTAGAGTAAAGTGGAAGAATTATCA
GATGATGAAGACTTTGATAGACAGATTGAAGAGGATTTCCTCAGTGGAGGTGATTAAGAC
GATGACTTCGATATGGAAGAAGGTTCACTAGGGAGCGGACCAAATGATGGTTTTGCAGTA
ATGGAAAATGAATTTTATCCCGAAGAGGAAGCAGAATCAAAGCTATCACCTGAAGAGAAG
AAGAAGCAAGCTGATCAACGTAAAAAGCAGAAGAAGCTAGAACAATTAGAGAAGAAAATC
AAAACTTTGTCAAAGAAGTAGGAGAAGGATAAAACCAGTGTGAGAGTGGCTTCTGAGATT
AAGAACAAGAGTAAAAGAAGGGAGATCGTTATCTTGCAAAAGATGGCTTAAAAGCAATAA
AAGCTGATTGGTAAACTTAAGAAGCAAAAGGTTAGAGCTGAGTAGGGAGAGGAGGCAATG
CCCAGAGGAGTCACTAAAACTATTGAAAGCATGAGAGTCGCTGATGAAACATTGATCTAA
GAGGGAGATGATGAAGAAATCAAGGGAGAGCAAGACATGGATGAATTCAACAAATACTTC
AAAAATGAAACTAAACCTAAAATTCTTATGACTACTAATAGAAGGCCAAAGGGTAACTTG
TTTGATTTCTTGAAGGAAGTCAAAGAGGCAGTGCCAAATACTGAATATTACGAGAGAAAA
AACTTTAGAATAAAGCAAATCATTGATTGGGCTAAGGGAAGAGACTTCACTGATGTTATG
GTGTTCTATGAGAAACATGGCAACCCTCACACATTAATTATGAGTCATCTCCCTGATGGG
CCAACAGCTTCATTTAGAGTATCTGGAGTCAAACTAAGAGCAGAGATTTATCATCATGCT
GTACCTTCAAGTTACAACCCGGAATTAATCTTAAACAATTTTGACACTATGCTTGGTCAC
CGTATTGGTAGAATGTTGGCAGCTCTCTACCCTTAAAACCCAGAATTTAGAGGAAGGCGT
GTTGTTACTTTTCACAATTAAAGAGATTTCATTTTCTTCAGACAGCATAGATATGAGTTT
ACTGAAGATCACTAAAGAGCTAATCTACAAGAAATAGGTCCTAGATTTACTCTTAAATTG
CATAGTCTATAACTTGGTACCTTAGATACCAAATTTGGAGAATTTGAATTCATCTACAAA
CCTAAAATGGGAGTTAATAGAAAGCAGTTCTTTATGTGA


>Contig22325.0.g46(protein)
MGKKVKKQQISIINDGDDEVVSKKQSKKLGKDKNNRKDKKKDDKNSKKQKKVQSKVEELS
DDEDFDRQIEEDFLSGGDQDDDFDMEEGSLGSGPNDGFAVMENEFYPEEEAESKLSPEEK
KKQADQRKKQKKLEQLEKKIKTLSKKQEKDKTSVRVASEIKNKSKRREIVILQKMAQKQQ
KLIGKLKKQKVRAEQGEEAMPRGVTKTIESMRVADETLIQEGDDEEIKGEQDMDEFNKYF
KNETKPKILMTTNRRPKGNLFDFLKEVKEAVPNTEYYERKNFRIKQIIDWAKGRDFTDVM
VFYEKHGNPHTLIMSHLPDGPTASFRVSGVKLRAEIYHHAVPSSYNPELILNNFDTMLGH
RIGRMLAALYPQNPEFRGRRVVTFHNQRDFIFFRQHRYEFTEDHQRANLQEIGPRFTLKL
HSLQLGTLDTKFGEFEFIYKPKMGVNRKQFFM