Identifiers and Description

Gene Model Identifier

Contig5106.0.g88

Standard Name

RPDL1

Aliases

Contig5106_0_g88

Description

DNA-directed RNA polymerase delta subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam05066 ) DNA-directed RNA polymerase delta subunit
  • ( pfam12884 ) Transducer of regulated CREB activity, N terminus

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5106.0.g88(coding)
ATGCCTTCTCAAATTTATATTCAGATCAACAAATTTGCTAAGGAATATTGCTAGTAGTAG
CTGGATTTACTTCATTAGCAATCAACTGTGTAAGTAAGCAAATAATTTGAAGAAGATTGC
AATTTTAAGCTTGCAATGATAGAAAGAACAAACACTCAGTACTCATGCTCACCTTGTTAG
AATGGTTAAAATGTAGGGAATCAGAGTTGCTAATACGACTGGTCAGTCCTGATTTCCTCT
AAGTATATTTATGATGAAAATGTCAACTTGTCTCTATCAAGAAATATGTCAGCAGTTAGG
TTTCTTTTCCACTCTCAAACCTAGCAGCATTAGACTTTACAATTTCAGCAGATTCTCAAC
TAGTAGAGATAAATGTAGCAGCAGTAGTAGCTACCTCATGCTTAACAAAACTTATCCAAT
GAACTAATGATTAACTAATTGTTGAATGTGACCCAGGAACAGGCTCAAAAGGTCAAAGTC
AAGGAGTTATTGAATCATCTTGAGAAACTTTGCACTGTGTCAGAGCAGACTAAGTTTAAC
TACAAATGA


>Contig5106.0.g88(protein)
MPSQIYIQINKFAKEYCQQQLDLLHQQSTVQVSKQFEEDCNFKLAMIERTNTQYSCSPCQ
NGQNVGNQSCQYDWSVLISSKYIYDENVNLSLSRNMSAVRFLFHSQTQQHQTLQFQQILN
QQRQMQQQQQLPHAQQNLSNELMINQLLNVTQEQAQKVKVKELLNHLEKLCTVSEQTKFN
YK