Identifiers and Description

Gene Model Identifier

Contig672.1.g43

Standard Name

RPC31L1

Aliases

Contig672_1_g43

Description

DNA-directed RNA polymerase III subunit Rpc31

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam11705 ) DNA-directed RNA polymerase III subunit Rpc31

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig672.1.g43(coding)
ATGATTAATACTGGAGCTAAACTCTAAAATAATAAGTCCCCGAATAGTCGGTCACCTCTA
TAGAAATGTTAAAATAACAATAATATTAGAGTTCCCGAAAGCGGCAAGATTTCATCGGAT
AAGCAGAGTAAATAAAATCAGAATAGCGACCTAAAAATGAGTCTACAAAATCAGTATCAC
TCTATTGCTTCAATCAGTGAAGAAGGCTAAGTTTCATCACTTATATCCTTTGAAAATAGT
GTAAGCAATTTAGAGCAATTTATTCGTAATGACGAAACGACTATAAGAGAGGAGAAAGCA
AGCAATTAATTCAAAAATCAATAGAATCTTGAGTTAATTACTGAACAAATCAATAAGCAA
AAGTAAGCAAAGTCAAGTAAAAATAAGAAATAGTATGGTAAATCACTCGTTTTCTCGCCA
TAATCAGCTGATTAAACCATCGCATATTAAACAAATAAAAATCTATAAATTGATCCAAAA
GCAGCTAACACTTACACCCAATCTATGCCATTACAAGATCAAAACCTTAACATAAATATT
GGGCAAAAATGA


>Contig672.1.g43(protein)
MINTGAKLQNNKSPNSRSPLQKCQNNNNIRVPESGKISSDKQSKQNQNSDLKMSLQNQYH
SIASISEEGQVSSLISFENSVSNLEQFIRNDETTIREEKASNQFKNQQNLELITEQINKQ
KQAKSSKNKKQYGKSLVFSPQSADQTIAYQTNKNLQIDPKAANTYTQSMPLQDQNLNINI
GQK