Identifiers and Description

Gene Model Identifier

Contig14143.0.g92

Standard Name

RPB9

Aliases

Contig14143_0_g92

Description

RNA polymerases M/15 Kd subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam02150 ) RNA polymerases M/15 Kd subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGL070C0.000000019990673443141236RPB9 SGDID:S000003038, Chr VII
from 374827-374459, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14143.0.g92(coding)
ATGGCAAAAGTTAACTTTATCGTTTCAATTGAAAACTATGATGAATACGAAGACAAATAT
CTCCTCAATAGACCTATAGAAGCATTAGCAGATGCAAAAACTCCAGCCAAGATAAAAAAC
ATAAGATACACATTTTTTGAAGATAAGAGAAAAGAATTAATAAAGATAGTAAAAAAGGAA
AGAGATAGAATTATCCGATTGCTTGAAGAAGGCAATTCAGCTGGTTAAAAATTAGCTGTA
CTTTAAAAAGATTTATTGGCAATGGAATTATCTCAAAATTAATCTGACAACTGCGATGTA
GCAAGTTTGGCTTCTCATAATTTCAGTCCTATAAAAAGTTAAAGAAGTACTTTTGGTGGT
ATACTGCCAATGTCACTCGATAGATTAAATTCACAAACTACTAAAGCAACTACAATGAGT
CAAAATATAAGGCCATTTGCTGCATCTACTATTAATGGCTTTGGTTTGCATTCGCATTAA
TAAAGCATAACAGGTTCTGTTACAAGCGCATCAAATAAAAACTAAGAGTTCAATTTTAAC
ATGCCAGATACATAATTGAATACATTGAACTCATAAGCTTAGTAAAACTAGAACTTCAAC
ATGCAGTAGATTAATTAAGTGTTCGGTATTAATAATTAACAACTAAACACTTCAACCTCC
TAAAGTATCTTAGGCACGAAATTATAACAAAATCACATACCGTAATTACAGGGAAAGTAC
TCGACTAACAATTTACTTCATAACAACAATAAATCAGTAAATTTTCAATAAAATATAGTA
AGTGGTATGAATGAATTGCATAATGTTATGACTTCTACGAGCAGCTCTTAGAAAGGGTTT
TTGAGTAGTAGAATTGTCAATTAACGCTAAAAAGATGCACTTAAGAAGAAAGTGGCTCAG
TAGTTTAATGTCATGAAGAAAGCTGAATAATTTGAGGCTATAGAGGAACAGAAATCGATT
AAGCAACTTTTACGGAGAGAGGAGAAAAATTCAAGGATGCAAGACATCATGATGAACTAT
GAAGTCAGGTAGCTCAATGATCTGTAGTACAAATAATAAAAATTAGAAAGGTTGTTTAAC
AAATAGCATGAAAAACAGAAATAAGTAGATTAATTTTTACTAAAAAGAAAACAGGATATT
GAGAGTTCAAGAAAAGAACTTGATGAGAAGCATAGAGAAGCTGTTAACTAATTGCTATAA
AAACATGAAGACAAACGTCTGATTGTTGAGAATAAGTTTGAAATGATTTAGGGTAAAGAA
AGCGGAAGAACTTTACCTTTGAGTGAGAGATATCAATCTATGAGTTAGATTAATCTTACT
GAGAAGCTTAGAATGACCAAGGAAGTTGCAGAGATTCGTAGAGATGAAAAACTTAAACAA
ATAAAATCAAAACTTTAGCACAAAGAAGAGTTATTTAATAGACAATAGAAACAGTAGCAA
GTAAAAATTATGATAAACTAGGAGCAATTTTCTATGAAAGTTAAGAATAAAGAAATCAAC
AAGGAACGCCAAAGAAGAAAGGAAGAGTATTAAAAAGAGCTGTACTAATTAAAACTAATT
GAAGACGATGAAAAATATAAGAAGCTTAAGGAACTGAAGTAGAAAGAAATTGATAAGCGA
GTTAAGGAGCAAGTTAAAAATGAAACAGAGAAGCATATGTTGTAAGAAGTTATAGAAGAC
ATGTTCATAAAGAATCAGTTCGATATCAATACTTTGGAAGAGAAATCAAAGTAAATTGAA
ACAAATTAATCAGTAATTTCAACTTATCTCAAAATGAAAGGTAGAAAACGTCGAACTTAA
TCACAGTAAAAGATCACTATAAGTAAAGAAGCGCTTAATTGGATTCATAATGAGCCCAGA
CATTCAATAAGTTTTATCAAGTTTTCTGGTGATGAAATAGTCTGGTTCCCTAAAGTTTGC
AGAGGCTGTGATAAAGTGTTCAACAAAGAAAAAATCTTCTTGTGCATATTTTGCGACCCT
ACTTGTGCTTATTGTGAAAAATGCGGGAGACCATAGAGGCAAGGCGAAGAGGCTCACTCC
CATCCGCTTATGAGTTTGCTTCCTGATTTTGACAAGTATCAGGAGATACTGTTAACACCA
TAGAATTGCTAGGTTGGGGATATTGATAAAAATGTTGAGTGGAATACAGCATGCTATTCT
TGTCATAAACAAGTTAAGCATGGTCCAATGTTTTTGAGTATGCAATGTCTCAATAACATT
TTTATATGTCATGAATGTGAGTTTAGAAGGCCAATTCATACTCTGCCTCATGGTATGAGA
TTTTGCAGGGAGTGTGACAACATGCTCCAGCCTAAAGAGAAACAGGATGGTGACGGTTCA
ACAGGAGGATATTTGATCTATGATTGCCGTACCTGCGGGTACTCGGAGAGAGCCAAGCCT
GGCGATGAGGCAGACAACTGTGTGTACAGAAGTGAGCAGACAAAGATGAGTGACAAGTTT
CTAGTCGATGTCGAATGCATCAAAGATCCTTGTCTATCCAGAAGAATCGGTAGACCTTGC
AAGAGATGTGGCTGCACCCTGGCTGTGACATTCACAAACCCTAGCAAAGAGAGAATGAAC
CTGATCTTCGTGTGCACTCAATGTACTTTGTACTGGAGAAAGGATGAACTCGATGAGAAT
GATGTAGCTTCATCAGGCAGCGATTCAGATTGA


>Contig14143.0.g92(protein)
MAKVNFIVSIENYDEYEDKYLLNRPIEALADAKTPAKIKNIRYTFFEDKRKELIKIVKKE
RDRIIRLLEEGNSAGQKLAVLQKDLLAMELSQNQSDNCDVASLASHNFSPIKSQRSTFGG
ILPMSLDRLNSQTTKATTMSQNIRPFAASTINGFGLHSHQQSITGSVTSASNKNQEFNFN
MPDTQLNTLNSQAQQNQNFNMQQINQVFGINNQQLNTSTSQSILGTKLQQNHIPQLQGKY
STNNLLHNNNKSVNFQQNIVSGMNELHNVMTSTSSSQKGFLSSRIVNQRQKDALKKKVAQ
QFNVMKKAEQFEAIEEQKSIKQLLRREEKNSRMQDIMMNYEVRQLNDLQYKQQKLERLFN
KQHEKQKQVDQFLLKRKQDIESSRKELDEKHREAVNQLLQKHEDKRLIVENKFEMIQGKE
SGRTLPLSERYQSMSQINLTEKLRMTKEVAEIRRDEKLKQIKSKLQHKEELFNRQQKQQQ
VKIMINQEQFSMKVKNKEINKERQRRKEEYQKELYQLKLIEDDEKYKKLKELKQKEIDKR
VKEQVKNETEKHMLQEVIEDMFIKNQFDINTLEEKSKQIETNQSVISTYLKMKGRKRRTQ
SQQKITISKEALNWIHNEPRHSISFIKFSGDEIVWFPKVCRGCDKVFNKEKIFLCIFCDP
TCAYCEKCGRPQRQGEEAHSHPLMSLLPDFDKYQEILLTPQNCQVGDIDKNVEWNTACYS
CHKQVKHGPMFLSMQCLNNIFICHECEFRRPIHTLPHGMRFCRECDNMLQPKEKQDGDGS
TGGYLIYDCRTCGYSERAKPGDEADNCVYRSEQTKMSDKFLVDVECIKDPCLSRRIGRPC
KRCGCTLAVTFTNPSKERMNLIFVCTQCTLYWRKDELDENDVASSGSDSD