Identifiers and Description

Gene Model Identifier

Contig19419.0.g46

Standard Name

RPB8

Aliases

Contig19419_0_g46

Description

RNA polymerase Rpb8

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005496101.9991095569230066e-20RNA polymerase Rpb8 family pro
tein
SGDYOR224C4.998394530072393e-19RPB8 SGDID:S000005750, Chr XV
from 761265-760825, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19419.0.g46(coding)
ATGGACAGAGCAAAGATTATTGATGATACTATTCAAGTCATTAACATCAATCGTGACGGC
AAATTCTTCGAGAAGGTTTCAAGAATTGAAGCCAAGTCTGAAGTGAACAAGCTTGAAGTT
CAACTTGATGTGAACACTGATATCTACCCAATGGAAAAGGATGCTTACTATGCAATGTGC
ATCGCTTCATCTATCAACACTGATGGCTCAGAGGAGTTTGACATCTTCCGCTACCAATCA
GAGGGCAGTGTAGCTGGTCCAGATGGCCAGGGAAGTCTCCTTGACCAGTACGAGTATGTC
ATGCACGGTAAAGTCTTCAAGTACACTATTGACAATGACAAGATATCTGTGTTTATCAGC
TATGGTGGTTTGTTGATGAGTTTGACTGGCGGCTTGAAGGAACTCAAGAACCTTGAAATT
GACTCAAGAGTGTATCTCCTCATGAAAAAGATTTGA


>Contig19419.0.g46(protein)
MDRAKIIDDTIQVININRDGKFFEKVSRIEAKSEVNKLEVQLDVNTDIYPMEKDAYYAMC
IASSINTDGSEEFDIFRYQSEGSVAGPDGQGSLLDQYEYVMHGKVFKYTIDNDKISVFIS
YGGLLMSLTGGLKELKNLEIDSRVYLLMKKI