Identifiers and Description

Gene Model Identifier

Contig21831.0.g92

Standard Name

RPB7a

Aliases

Contig21831_0_g92

Description

SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam03876 ) SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
  • ( pfam00575 ) S1 RNA binding domain
  • ( pfam08292 ) RNA polymerase III subunit Rpc25

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR404C6.0002282540086176e-27RPB7 SGDID:S000002812, Chr IV
from 1277169-1276654, Gen...
T. thermophilaTTHERM_005792800.000000009000371344152433RNA polymerase Rpb7, N-termina
l domain contai...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21831.0.g92(coding)
ATGTTCTTTATTGTCACTATCGAGAAGGTAGTCAGAATTGAGCCATATGAGCTCGGCAAG
AACCTCATCTACAAGATCAGGAAGAAGATTGAGGACATCACTGTTGGTACCTGCTCTGGA
ACTTATGGTTACATCATCTAAATCATTTAGATGAAACCCTAGGACATTTCAGACGGCAGA
ATTCAGGATACAACTGGAGATGTGATCTACAAAGTCAAGTTCAAGGCTTTGGTTTTCCGC
CCCTTCCGTGGAGAGGTCTTGGACGGTGAAGTGATTGACATCACAGACAACGGATTCATG
ATTGAGTCAGGCCCACTCAAATCCTTCATCTCAACTATGAGAATTCAAAACTAGTATGCC
TATGACAAGAGTCACAACTAGTTTATCTCTAAGGACGACCCTAACTTGAGAATCACTGTG
GGAAGCAACATCAGGTACAAGATCGACCAGATTAAGTACGACAAGGGAGAATATACTGCT
GTGAGTTCTTTGGAGGATGGATACTTGGGTCCACTATCTTTGTGA


>Contig21831.0.g92(protein)
MFFIVTIEKVVRIEPYELGKNLIYKIRKKIEDITVGTCSGTYGYIIQIIQMKPQDISDGR
IQDTTGDVIYKVKFKALVFRPFRGEVLDGEVIDITDNGFMIESGPLKSFISTMRIQNQYA
YDKSHNQFISKDDPNLRITVGSNIRYKIDQIKYDKGEYTAVSSLEDGYLGPLSL