Identifiers and Description

Gene Model Identifier

Contig8949.0.g106

Standard Name

RPB6

Aliases

Contig8949_0_g106

Description

RNA polymerase Rpb6

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR187W4.9976494746363024e-29RPO26 SGDID:S000006391, Chr XV
I from 911257-911276,9113...
T. thermophilaTTHERM_004211704.999723464643358e-28RNA polymerases K / 14 to 18 k
Da subunit fami...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8949.0.g106(coding)
ATGTCAGATAGAGACGGAGGAGACAGCGACTCTGATAACTACAATGATCAAGACTCATAA
AACTTTGAGGATCAGATGGACATCATTGATGACGATGCTGAGGCTTTGGAGGCTCAAGCA
GCTGGAGGAGCTCCAGGTGAATATCTTGGCGGCAAGAAAAAGGCAAACAAGGAGCGCATC
ACTTCAAGTTTCATGACCAAGTATGAGAAAGCCAGAGTCCTTGGAACTCGTGCTTTGTAG
ATCTCTAAGAACGCCCCATTGATGATTCAGCCAATGCCAGGTGAACACGATCCCTACAAG
CTTGCCGAGAGAGAACTTAACGAGAGAAAAATCCCATTCATCATCAGAAGATATCTACCT
GATGGCACCTACGAGGACTGGAAACTCTCTGAACTCACCTATTGA


>Contig8949.0.g106(protein)
MSDRDGGDSDSDNYNDQDSQNFEDQMDIIDDDAEALEAQAAGGAPGEYLGGKKKANKERI
TSSFMTKYEKARVLGTRALQISKNAPLMIQPMPGEHDPYKLAERELNERKIPFIIRRYLP
DGTYEDWKLSELTY