Identifiers and Description

Gene Model Identifier

Contig486.1.g67

Standard Name

RPB5

Aliases

Contig486_1_g67

Description

RNA polymerase Rpb5, C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01191 ) RNA polymerase Rpb5, C-terminal domain
  • ( pfam03871 ) RNA polymerase Rpb5, N-terminal domain
  • ( pfam13643 ) Domain of unknown function (DUF4145)
  • ( pfam07866 ) Protein of unknown function (DUF1653)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR154C6.997646692526315e-42RPB5 SGDID:S000000358, Chr II
from 549009-548362, Genom...
T. thermophilaTTHERM_009414509.998720540547892e-23RNA polymerase Rpb5, C-termina
l domain contai...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig486.1.g67(coding)
ATGGACCTTGATCAAACAACTTTGCTCTATAGAGTGAGAAAGACTGTCTTGCAGATGTTA
AAGGACCGTGGCTACATCGTCAGTGACAAGAAGTTGAAGCAGACTATTGAGGAGTTCAAG
GCCACTTTCAACAACACTCGTGACTCACTCAATTTGATTGTTACAAAGAGACAGCAAGTT
GACCCTAATGACCCCAATTCCCAGGTTGCTCAAAACTCAGAGGAGTAGCAGAAACTCATT
GTATTCTTCCCAGATGTTGAGAAACTTAACATGGCTGCTCTCAAGCAAATTGCAATTAAG
ATGCTCGAAGTTAACTGCTTCAATGCTATCGTCATTATCAAGGGAGCAACTCAAATCTCA
AGAAGGGAACTTGATGAGTTGAAACCATGTGAAATCGAATGCTTCTTGCAACAAGAGCTT
CTCGTCAACATTACTGAGCATGAATTGGTGCCTAGACACGAAGTGCTCTCTGACAAGGCT
AAGCATGAACTTCTTAAGAAATATCGTGTTAAGGATTCTCAACTCCCAAAGATTCAAGTA
GACGATCCAATTGCTAGATACTATGGTGTGAAAAGAGGTTAAGTTATGAAAATTGTGAGA
GCTTCTGAGACTGCAGGTAGATATGTGACTTACAGATTGGCATATTGA


>Contig486.1.g67(protein)
MDLDQTTLLYRVRKTVLQMLKDRGYIVSDKKLKQTIEEFKATFNNTRDSLNLIVTKRQQV
DPNDPNSQVAQNSEEQQKLIVFFPDVEKLNMAALKQIAIKMLEVNCFNAIVIIKGATQIS
RRELDELKPCEIECFLQQELLVNITEHELVPRHEVLSDKAKHELLKKYRVKDSQLPKIQV
DDPIARYYGVKRGQVMKIVRASETAGRYVTYRLAY