Identifiers and Description

Gene Model Identifier

Contig12754.0.g41

Standard Name

RPB4b

Aliases

Contig12754_0_g41

Description

RNA polymerase Rpb4

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12754.0.g41(coding)
ATGGTAGAATCAAACTCTCATGATTTCATTGCAAGTGAAATTGGAGCAAACTTCGTTGAT
GCTTATTTGATCTCGAATGCTGAGGTTGTTCAGTTGATGAAGGGAAACCGCAGTGACAAG
GACAAATTGGTAGGAGCAGGAGTGGGTCTCAACATGCCTCAAGGAATCAACCAGATCGGA
GATGAGATGCAGAGAAAGACTGAACAGTATGTCAACAAGTTCAACATCTTTGAGCAGAAG
GATAAAGTCATGGTCATCAGAGCCGAGATGCAGAAATTCAATGAAATCCCAGAAATTGAG
TTGATCTTGCTTTGGAATTTGGCTCCTGGCAGCTATGAGGAAGCTGTGACTTTGATCCCC
TAACTCAAAGATAGACCTGAAGATGCTATCAACCATTTGATCGAGTTCATCAACAAGAAC
AAGACTTGA


>Contig12754.0.g41(protein)
MVESNSHDFIASEIGANFVDAYLISNAEVVQLMKGNRSDKDKLVGAGVGLNMPQGINQIG
DEMQRKTEQYVNKFNIFEQKDKVMVIRAEMQKFNEIPEIELILLWNLAPGSYEEAVTLIP
QLKDRPEDAINHLIEFINKNKT