Identifiers and Description

Gene Model Identifier

Contig8173.0.g80

Standard Name

RPB3

Aliases

Contig8173_0_g80

Description

RNA polymerase Rpb3/RpoA insert domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01000 ) RNA polymerase Rpb3/RpoA insert domain
  • ( pfam01193 ) RNA polymerase Rpb3/Rpb11 dimerisation domain
  • ( pfam04337 ) Protein of unknown function, DUF480
  • ( pfam13237 ) 4Fe-4S dicluster domain
  • ( pfam12838 ) 4Fe-4S dicluster domain
  • ( pfam13187 ) 4Fe-4S dicluster domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001938498.99739772315193e-58DNA-directed rna polymerase II
subunit
SGDYIL021W8.999409812021828e-43RPB3 SGDID:S000001283, Chr IX
from 312905-313861, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8173.0.g80(coding)
ATGTATGGAATTGATCAAATCAACACTTCCTCAGCTTTTGGTTAATCACGATTTGCAAAC
TCTGTCCCCTCAAAGAATCAAGCAGCAGGAAAGGGTTTCAATGAGCCGGAGATCAAGATT
CTTGAGTTGAGCAAGTACGTGATTAAGTTTGAATTGTTGAACACTGACCTCTCTGTTGCA
AACTCCCTTCGCAGAATCATCATCGCCGAAGTCCCCACTATGGCAATTGATCTTGTTGAG
GTTGTTGAGAATACCTCTGCATTGCACGATGAGTTCATCGCACACAGATTGGGATTGATC
CCTATGTAGAGCTTTGATGTTGACAAGTTTCAATTCAGTGACAAATGCGCTTGCAGTTCA
AAGTGTGTGAACTGCTCTGTCCAATTCAAGCTACATGCAGTTTGCTCAGACAGAGATCAA
ATGGAAGTCAATACTAGACACATCAACCCACTCTCTGAGTCAAGTATCATGCCTGTTCAC
TATGTTGACAGTCAAGGAAAAGAAGAAGATCCTATCTTGATCATGAAACTCAGCAAGAAC
TAGCAGCTAGATATGAACTTGATTGCAAGAAAGGGTACTGGAAAACTTCATGCTAAATGG
TCTTCAGTTGCTACTTGCTAGATGAGAAAGGAGCCAATAGTAGAGATTGATCAGGACAAG
ATCAACAGAGATCTCGATGTGCAAAAGAGAAAGGAGTTTGTAGCGACATGCCCAAGAAAT
GTCTACAAATTCAATGAGATGAGAAACGCTGTTGAGATAGAAGATGCTGACAAGTGTATT
TTGTGTATTGAATGTGTGAGATTTGCTCAAGCAAACGGCCTTGATAGAGCAGTCAAGATT
GCAGAGAGAGAAGAAAAATTCATCTTCACAGTTGAGTCTACTGGAGTCCTCGCACCTGAA
GATATCATCACTAGAGCTTTGACTATATTGAGCCACAAACTCAAGTCTCTCGCAGACTCA
ATGAACAAGTATAGAATTAACGCTGATTGA


>Contig8173.0.g80(protein)
MYGIDQINTSSAFGQSRFANSVPSKNQAAGKGFNEPEIKILELSKYVIKFELLNTDLSVA
NSLRRIIIAEVPTMAIDLVEVVENTSALHDEFIAHRLGLIPMQSFDVDKFQFSDKCACSS
KCVNCSVQFKLHAVCSDRDQMEVNTRHINPLSESSIMPVHYVDSQGKEEDPILIMKLSKN
QQLDMNLIARKGTGKLHAKWSSVATCQMRKEPIVEIDQDKINRDLDVQKRKEFVATCPRN
VYKFNEMRNAVEIEDADKCILCIECVRFAQANGLDRAVKIAEREEKFIFTVESTGVLAPE
DIITRALTILSHKLKSLADSMNKYRINAD