Identifiers and Description

Gene Model Identifier

Contig19200.0.g86

Standard Name

RPB2b

Aliases

Contig19200_0_g86

Description

RNA polymerase Rpb2, domain 6

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000772309.997093137033517e-262DNA-directed RNA polymerase, b
eta subunit fam...
SGDYOR151C9.997093137033517e-262RPB2 SGDID:S000005677, Chr XV
from 616671-612997, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19200.0.g86(coding)
ATGTTCGCACCAGGATCTAGTATCCCACCTAATCATTAAAATATGTTTTAGCAGCAGCCA
ATGAGGGTCAATGGTGGTGGTGGTCCCCCACCTTTAAACAATCCAATAGTTCAATAGCTG
TAGGATTAAAATGAAATCAACTAGGATGACGCCTGGACTGTCATAAGATCCTATTTCAAG
CAACATGGTCTAGTCTCACAGCAGATATCATCATTCGATAGATTCGTCAACTTCAGCTTG
CAAGAAATTATTTCAGAAAACGGATAGCTTCAAATTCCATACACCCCTCAATATCAACTA
AATAAGCAACAGCATGAGACTGACAAGGACATAGTATACGAGGTGCAATTCAAACAAGCA
AGTGTGAATTCATACCCCCGCTTGTAAGAGGAAGATGATACTTACTCACCTATATTCCCG
CATGAAGCCAGGATGAGAAACCTCACTTATGCTACAGAGGTATTTGTTGATATAACACTT
AGCAAGAAGGAACTTGACAAAGAAATGATAATTGATCCTAAAACTGGACAAAGACACCAG
AAAGTAAAGCAAGTAATGCAAGAGTATGATGAAGCTAGAGTCACAATTGGAAAAATCCCC
GTGATGTTGAGATCAAAGTTCTGCTAATTGCACAGCTTAAATTAGATGCAGCGCATGAAA
GAAGGCAAGGATTGTCAGTATGACTAAGGAGGTTACTTCATCATAAATGGCAGTGAAAAA
GTTATTGTTGCCCAAGAACGTATGGCGAACAACTAAGTAAACGTTTTTCACAAGAAACCT
CCCTCGAAGTACTCATGGGTAGCTGAGATTAGATCTCAAGCTGAAAACTCAAACAAACCT
CCACAACAACTCTTACTTTTCTTGAAGAGTAGATATAAAAGTTCAGGACCAGGATTCGGT
TAAGCCAATCATAGTACTAGCAAGTTTGGACAGAGTATTTATGTGAGTTTACCCATGATA
AAAGAACAGATTCCATTAGTTATTCTCTTTAGAGCTCTTGGTACTATATCAGATAGATAG
ATTTTGAGCAGAGTTTGCTTTGATTGCCCTGATGATCCTGAAATGGGTGAAGCTCTTCGT
GCAAGTTTAGAAGAATCTAAGATTGTCGACACTCAAGAAGATGCAATGGATTATATAGCT
AAGCGTGGTTCAGCTCAACCTTACATTCGAGAGAATCGTCTGACTTACACAAAGCTTATG
CTTGAAAGTGAGTTCTTGCCACATATTTCTACACTTCCTTAAGATATGCCAAAGAAGTCC
TTCTTCCTCGGATATATGGTTAACAAACTCTTGAAAGCTTTTCTCGGCCGCATTGATGAA
GACGATCGCGACTACTATGGAAAGAAAAGACTAGATATGGCTGGAAGTTTACTAGCTACA
AATTTCAGATAACTTTTCAGAAACTTCACAGACACCATGAGAAGAATCTTAAAGCATGAG
ATTGACTCTGGCAAAGAACAAATTGTGCTGTAGAACTCCATTAAGCAAGATATCATCACG
AGAGGGCTTAGAACTGCACTTGCAACCGGTAATTGGGGTAGAGACAAGAATGGAGATGTG
CAAAAGACTGGAGTGGCATAGGTGCTCAATAGATTAACTTTTGCATCTTCGCTAAGTCAT
TTGAGAAGACTGAACACACCTATAGCTAAGACAGGTAAGCTTGCTAAGCCTCGTCAATTA
CACAATACTCATTGGGGAATGATCTGTCCAGCTGAAACACCCGAAGGTGCGGCCTGTGGA
CTTGTGAAGAACTTAGCCCTAATGACTTTTGTATCAGTTGGTTCTTAACCTTCTTATCTA
ATTTCAATTCTTGAGGATCTCGGAGTGGATAGACTTGATGACATGAATTAAGTTGGAAGT
GGACGCTAAGTAAGAATCTTTGTAAATGGTAACTGGTTCGGCACACATGCAAACCCCGAT
GATCTCATTAAATCTATGCTCAAGCTTAGAAGAACACACTAGATACCAAAAGAAATTGCT
ATAGTTAGAGATTTACAGAACAAAGAAATCAGATTTTACACTGATTCAGGCAGAGTCCAG
AGACCTCTGTTTATTGTTTAAAACAACAATATCAAACTAAAGAAGAAGCACATTTCTTTG
TTAGAGAAAAATGAATATAACTTTGATGATACAATTAAAGAGGGGCTTGTTGAGTTTTTA
GATGTTGAAGAGGAAGAAACTGCCATGATTGCAATGCATCTACAAGATTTGAAGAGCAAG
AAAGAAAATAGAGTGACAACTTACACTCATTGTGAAATTCACCCCTCCATGATTTTAGGC
GTATGTGCTTCAATCATTCCCTTCCCTGATCACAATTAATCACCAAGAAATACTTATCAA
AGTGCTATGGGGAAATAGGCTATGGGAATTTACACATCAAATCACAGCATAAGAATGGAT
ACACTTGCTCATGTTCTCTATTATCCTTAAAAACCATTGGTTTGCACAAAGTCAATGGAC
TTCTTGCACTTTAAAGAACTGCCTGCAGGTTCCAATGCAATAGTGGCAATCGCTTGCTAC
ACTGGCTACAACCAAGAAGATTCGATCATATTCAACCAGTCAAGCATAGACAGAGGCATC
TTCAGAAGCGCTTTCTTCAGAACGTACAGTGAGACACAGGAGAAAGATGAGAGATTTGAG
ATTCCTGACTTCAAGAAGTGCTCTGGTCGCAAGCATGGCACCTACGATAAACTTGACATC
GATGGACTCATTAATCCAGGCAATCAAGTCAGTGGGGATGATGTCATTATTGGCAAGACC
ACTGCTATCAAAATGAATGAGAACATGAATGGAAATGCTAATTCATCTCAAGGTGCAGAT
CCCATGTTCTTTGTGAAATCTAGAAGAGATGTATCAACCTGCCTCAAACACTCAGAAACT
GGGAAAATTGATCAAGTAGTCCTGACTGTCAACGAGCAAGGAGAAAGATTTGTGAAAATA
AAGATGAGGAGTGAACGTATTCCATAGATTGGAGATAAATTTGCTTCTAGACATGGTCAG
AAGGGAACAGTAGGCATGACCTACAGACAAGAGGACATGCCATTCACAAGAGAAGGGATA
GTGCCTGACTTAATCATCAATCCTCACGCTATACCCAGTAGAATGACAATTGGTCACTTG
ATTGAATGTCTCGGCAGTAAAGTAGCTTCATTAACTGGTACTGAGGGTGACGCCACACCC
TTCTAGAAAGTAGGAGTAAAGGACACAGTGGAGCAAATCTCAAAGCGCCTTCATGAATGT
GGGTATCAATTAAGAGGCAATGAAGTGATGTACAACGGCTTCAATGGCAAGAAAATGGAG
GTCATGATTTTCCTTGGACCAACTTATTATTAAAGACTTAAGCATATGGTGGCAGACAAG
ATTCATTCAAGAGGCAGAGGGCCAACTCAAATCTTGACTAGACAGCCAACTGAAGGTCGT
TCAAGAGATGGAGGACTCCGTTTTGGAGAGATGGAACGTGACTGCATGATTTCACATGGA
GCTGCTAGGTTCTTGAAGGAAAGATTATTTGATGTCTCTGATTTCTATAGAATTCATATG
TGTGAAGTATGTGGGCTGATTTGTGTTGGTAACCTCTCTGAACAGCGCTTTGAATGCTAC
AACTGCTAGAACACTTCTAAGATCTGTCAAGTGAACATCCCTTACGCCTGCAAACTACTC
ATGCAAGAACTCATGGCCATGCAAATTGCTCCGAGACTCAAAGTACATGAATTCAAGTGA


>Contig19200.0.g86(protein)
MFAPGSSIPPNHQNMFQQQPMRVNGGGGPPPLNNPIVQQLQDQNEINQDDAWTVIRSYFK
QHGLVSQQISSFDRFVNFSLQEIISENGQLQIPYTPQYQLNKQQHETDKDIVYEVQFKQA
SVNSYPRLQEEDDTYSPIFPHEARMRNLTYATEVFVDITLSKKELDKEMIIDPKTGQRHQ
KVKQVMQEYDEARVTIGKIPVMLRSKFCQLHSLNQMQRMKEGKDCQYDQGGYFIINGSEK
VIVAQERMANNQVNVFHKKPPSKYSWVAEIRSQAENSNKPPQQLLLFLKSRYKSSGPGFG
QANHSTSKFGQSIYVSLPMIKEQIPLVILFRALGTISDRQILSRVCFDCPDDPEMGEALR
ASLEESKIVDTQEDAMDYIAKRGSAQPYIRENRLTYTKLMLESEFLPHISTLPQDMPKKS
FFLGYMVNKLLKAFLGRIDEDDRDYYGKKRLDMAGSLLATNFRQLFRNFTDTMRRILKHE
IDSGKEQIVLQNSIKQDIITRGLRTALATGNWGRDKNGDVQKTGVAQVLNRLTFASSLSH
LRRLNTPIAKTGKLAKPRQLHNTHWGMICPAETPEGAACGLVKNLALMTFVSVGSQPSYL
ISILEDLGVDRLDDMNQVGSGRQVRIFVNGNWFGTHANPDDLIKSMLKLRRTHQIPKEIA
IVRDLQNKEIRFYTDSGRVQRPLFIVQNNNIKLKKKHISLLEKNEYNFDDTIKEGLVEFL
DVEEEETAMIAMHLQDLKSKKENRVTTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQ
SAMGKQAMGIYTSNHSIRMDTLAHVLYYPQKPLVCTKSMDFLHFKELPAGSNAIVAIACY
TGYNQEDSIIFNQSSIDRGIFRSAFFRTYSETQEKDERFEIPDFKKCSGRKHGTYDKLDI
DGLINPGNQVSGDDVIIGKTTAIKMNENMNGNANSSQGADPMFFVKSRRDVSTCLKHSET
GKIDQVVLTVNEQGERFVKIKMRSERIPQIGDKFASRHGQKGTVGMTYRQEDMPFTREGI
VPDLIINPHAIPSRMTIGHLIECLGSKVASLTGTEGDATPFQKVGVKDTVEQISKRLHEC
GYQLRGNEVMYNGFNGKKMEVMIFLGPTYYQRLKHMVADKIHSRGRGPTQILTRQPTEGR
SRDGGLRFGEMERDCMISHGAARFLKERLFDVSDFYRIHMCEVCGLICVGNLSEQRFECY
NCQNTSKICQVNIPYACKLLMQELMAMQIAPRLKVHEFK