Identifiers and Description

Gene Model Identifier

Contig1141.1.g1

Standard Name

RPB2a

Aliases

Contig1141_1_g1

Description

RNA polymerase Rpb2, domain 6

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000772309.997093137033517e-262DNA-directed RNA polymerase, b
eta subunit fam...
SGDYOR151C9.997093137033517e-262RPB2 SGDID:S000005677, Chr XV
from 616671-612997, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1141.1.g1(coding)
ATGTTAAACGCTGAAGAGTACGATGACATGAGAAAAGATTTCTCAGGCTTCGATAAATTT
AAAAAAGAAATCGACTAAGACGATGCATGGGCAGTAATTCGCTCGTATTTCAAGCAGCAT
GGTCTGGTCTCTCAATAAATCTCTTCTTTCAACAGATTCTTGGAGATGAACGTCCAAGAA
ATAGTTAAGGAGCATAAGCACAATAGAATCAAGGTAGAACCTCAGTATTTACCATCTGAG
GGGAGAGACTCCACTCAAGAAAATATCTACTACGATGTTATTTTCGAATAAGTTCACGTC
AACAACTCTCCTAGAATTCAAGAGTCTGATGAGAGTTACTAAGCCGTGTTCCCTCATGAA
GCTAGAATCAGAAACTTGACCTATGCTACTGAAATTTATGTTGATGTTAAATTGCAAAAG
CTACAATAAATACCCTATGACAAGACTGGTTTGAGGGACGGTGAAAAGCGAGAGCCTAAG
TTTACCATATTAGAAGACTCAAAGCCAATTCAAACTTTCTTAGGTAAAGTACCAGTTATG
GTTAGATCAAAGTTTTGTCACTTGAGAAATTTGCAAGATCATGAAATCGTAAGAAATGCC
AAGGAATGTCTATATGATTAGGGAGGATACTTTGTCATTAATGGCGGTGAAAAAGTTATC
ATTGCTTAAGAAAGAATGGCCAACAATATTGTACTTGTGTTTCATAGAAGACCACCTTCC
AAATATAGTTGGGTTGCTGAAATCAGATCTTAAGCTGAAAATTCAAACAAACCTCCTCAA
TAATTCATGGTTGCTATTTAAGAGAAGATTAAACTAGGAGAATAAGGAGGTGGCAACTAC
GCCAGAACTATTTGTGCAACAATTCCAGCAATTAGAGAGCCAATTCCAGTTGCTATATTG
ATGAGAGCTTTGGGATGTGTTAGTGACAAGCAAATCATAAATAAGATCTGCTACGATCCA
GAAGACTCCGAAATGTGTGAATCTTTGAAGCCATCTCTTGAACAAGCCATGACTGTAATG
ACAGAAGAAGATGCCCTTGATTTCATTTCAAAAAGAGGAAGTGGAGCACAGTACTCAAGA
GACACTCGTATTTAGTACGCTCAAAAGATTCTCGAAACCGAATTCTTGCCACATGTGTCA
ATGAACGCAGAGGGTCTGTATAAGAAATCTTACTTCGTTGGATACATGGTCAATAGATTG
ATTCAAGCATCTCTAGGCAGAACATCAGAAGATGATAGAGATTACTATGGTAAGAAGAGA
ATGGATATGGCTGGTTCACTATTAAGTGGATTGTTCAGATAATTGTTCAGATAAACAACA
GATGACATGCTTAAATATCTTAAGAGAGACATTGATAATGGCAAACAAATTCTAAGTTTA
GCATCTGCTATTAAGAGTGATACTATTTCAAGAGGATTAAAGAGTGCTTTAGCCACAGGA
AATTGGGGTAAAGATAAATAAGGAGACGTGTAAAAGACTGGAGTAGCCTAAGTGCTAAAT
AGATTGACTTTTGCTTCTTCATTATCCCATTTAAGAAGACTTAACACACCCTTAGCTAAG
TCAGGTAAATTGACAAAGCCTCGCCAGCTCCATAATTCCCATTGGGGTATGGTTTGCCCA
GCTGAAACTCCTGAAGGTCAAGCTTGTGGTCTTGTTAAGAATCTATCACTAATGTCTCTA
GTATCAGTTGGTTCACCTAACAAGACTCTTATTGAAATCTTAGAGGACTTTGGTGTAGAG
GATTTAACATCTTTAGATCCAATTATTCTGCAGAATAAAGAATTAGTTAAGGTTTTTGTA
AATGGAAATTGGATTGGATGTCACAGAAATGCTACTGATTTAGTAAAGAACATTAAAGAT
ATGAGAAGAACATACACAATACCTAAGGAAATATCTATAGTCAGAGACATTTATACAAAA
GAAATCAAGTTCTTTACTGATTCTGGTAGAGTGCAGAGACCACTATTTATTGTAGAAAAT
TCAGCTTTAAGAATTAAAAAGTTCCATATTCCTCAACTCATTAATGGTTCAAAGAATTTC
GAGGATTTACTTTAGGAAGGTTTATGTGAATTCTTGGATGTAGAAGAAGAGGAAACTGTT
ATGATTGCTATGACGTTAGATGATTTAAAGGGATAGAAAGCAATAGAATACCATTATACT
CATTGTGAAATTCATCCTTCAATGATTCTTGGAGTGTGCGCCAGTATTATTCCCTTCCCA
GATCATAACCAGTCCCCAAGAAATACTTATCAAAGTGCTATGGGAAAACAAGCTATGGGA
GTATATACAAGTAACTATCAAATGAGAATGGATACACTAGCTCATGTACTCTATTATCCA
TAAAAGCCATTAGTCTGTACAAAATCCATGGAGTTCTTGCATTTCAAGGAACTTTCATCA
GGCCTCAACGCTTCTATTGCTATCGCATGCTATACTGGTTATAATCAAGAAGATTCTATT
ATGCTTAATTAAAGTGCCATCGACAGAGGTTTCTTTAGATCTGTCTTCTTTAGAACATAT
GATGATTGCTCTAAAGAAGGAGAAGTATTTGCTATTCCAGATTTCGCCAAGACATCAGGC
AGAAAGCATGGAGACTATGATAAACTTGATATTGATGGACTTATTTGTCCAGGAGTTTTG
GTTAGTGGAGATGACATCATAGTTGGAAAAGTAGCAAAGATGACTTCTAATACATTCAAT
GAAGATTTAAGAGACTCTACTGCCAAAAAGTTTAAAGATTGCTCAACTCCTTTAAAACAT
TCTGAGTCTGGTATTATAGACTAAGTCATTCTTACCACTAATGATGAAGCTCAAAAGTTT
ACCAAAGTAAAAATGAGAGCAGTGAGAATTCCATAAATTGGTGATAAATTTGCCTCTCGT
CATGGTTAAAAAGGTACTTGTGGTATGACTTATAGACAAGAGGATCTACCATTTACTAGA
GAAGGTGTAGTTCCAGATATGATTGTTAATCCTCATGCTATCCCTTCAAGAATGACAATT
GGGCATTTGATTGAATGCTTGTTAAGTAAAGTAGCTTCATTAAATGGTTCTGAAGGTGAT
GCAACTCCTTTCTGTGGGTAGAATGTGGATGAAATTAGTTAGTTACTTCATGAATTAGGC
TATCAAAGATATGGAAATGAAGTCATGTATAACGGATTTACTGGTAGAAAGTTTGAAGTT
TTGATCTTTTTAGGACCTACTTTCTATTAAAGACTAAAGCATATGGTTGGTGATAAGATT
CACTCAAGAGGAAGAGGACCTACTTAAATTTTGACAAGACAACCAACTGAGGGTAGATCA
AGAGATGGTGGCTTGAGATTTGGAGAAATGGAAAGAGATTGCATGATATCGCATGGTGCA
GCTAGATTCCTTAAAGAAAGACTATTTGATGTATCAGATTGCTATAGAGTGCATATTTGC
CAAACATGTGGCCTGATTTGTCAAGCTAATCTTGCCGAATAAAGATATGAATGCAATAAC
TGCAATAACACCTCAAACATCTGTTAAGTTAAAATTCCTTATGCTGCTAAACTACTTATC
CAAGAATTAATGGCCATGCAGCTTGCACCTAGACTTAGAACTTCAATTATAGACTGA


>Contig1141.1.g1(protein)
MLNAEEYDDMRKDFSGFDKFKKEIDQDDAWAVIRSYFKQHGLVSQQISSFNRFLEMNVQE
IVKEHKHNRIKVEPQYLPSEGRDSTQENIYYDVIFEQVHVNNSPRIQESDESYQAVFPHE
ARIRNLTYATEIYVDVKLQKLQQIPYDKTGLRDGEKREPKFTILEDSKPIQTFLGKVPVM
VRSKFCHLRNLQDHEIVRNAKECLYDQGGYFVINGGEKVIIAQERMANNIVLVFHRRPPS
KYSWVAEIRSQAENSNKPPQQFMVAIQEKIKLGEQGGGNYARTICATIPAIREPIPVAIL
MRALGCVSDKQIINKICYDPEDSEMCESLKPSLEQAMTVMTEEDALDFISKRGSGAQYSR
DTRIQYAQKILETEFLPHVSMNAEGLYKKSYFVGYMVNRLIQASLGRTSEDDRDYYGKKR
MDMAGSLLSGLFRQLFRQTTDDMLKYLKRDIDNGKQILSLASAIKSDTISRGLKSALATG
NWGKDKQGDVQKTGVAQVLNRLTFASSLSHLRRLNTPLAKSGKLTKPRQLHNSHWGMVCP
AETPEGQACGLVKNLSLMSLVSVGSPNKTLIEILEDFGVEDLTSLDPIILQNKELVKVFV
NGNWIGCHRNATDLVKNIKDMRRTYTIPKEISIVRDIYTKEIKFFTDSGRVQRPLFIVEN
SALRIKKFHIPQLINGSKNFEDLLQEGLCEFLDVEEEETVMIAMTLDDLKGQKAIEYHYT
HCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYTSNYQMRMDTLAHVLYYP
QKPLVCTKSMEFLHFKELSSGLNASIAIACYTGYNQEDSIMLNQSAIDRGFFRSVFFRTY
DDCSKEGEVFAIPDFAKTSGRKHGDYDKLDIDGLICPGVLVSGDDIIVGKVAKMTSNTFN
EDLRDSTAKKFKDCSTPLKHSESGIIDQVILTTNDEAQKFTKVKMRAVRIPQIGDKFASR
HGQKGTCGMTYRQEDLPFTREGVVPDMIVNPHAIPSRMTIGHLIECLLSKVASLNGSEGD
ATPFCGQNVDEISQLLHELGYQRYGNEVMYNGFTGRKFEVLIFLGPTFYQRLKHMVGDKI
HSRGRGPTQILTRQPTEGRSRDGGLRFGEMERDCMISHGAARFLKERLFDVSDCYRVHIC
QTCGLICQANLAEQRYECNNCNNTSNICQVKIPYAAKLLIQELMAMQLAPRLRTSIID