Identifiers and Description

Gene Model Identifier

Contig5780.0.g96

Standard Name

RPB1b

Aliases

Contig5780_0_g96

Description

RNA polymerase Rpb1, domain 5

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005389409.997093137033517e-262RNA polymerase Rpb1, domain 2
family protein
SGDYDL140C9.997093137033517e-262RPO21 SGDID:S000002299, Chr IV
from 210561-205360, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5780.0.g96(coding)
ATGATAATCACGGGTACCAAGAATACTCACTCGTATATTGAAGTCAAGAAGCCGAGCGCC
ATTGAGTTCTGTCTCCTTGATCAAGACGAAATTCTCAAATCAAGTGTAGTATCAATAAAA
AATGAAAGAATTTATGATGTGAACATGATCCCAGCTTTTGAAGGAGTCAACGATCCAAGA
ATGGGCACTATGGATAGAGATCGCTTATGTTTTACTTGCAAGGGTTCTCAAGTAGATTGT
CCAGGCCACTTTGGTCATATAGAGCTAGCTAAACCAGTTTATCACAGAGGTTGCTTAGAA
TACATCAAGAAGATTCTTAAGTGTTTGTGTTTCAGTTGTGGTAAACTACTCTACCCTAGA
GAAAAAGATCACGTTGATTAGATAATGCGCATTAAGAGCCCCAAGCATAGGTTCATGTAA
ATCATGAAACATCATGAAAAATATGTCTTCAGATATTGCGAGTCATAGAATGGTGGATGT
GGAATGAAGCAGCCTAAAGTCTTAAAGAAAAGTTTGGCACTGGAAGTAGAATATTTCAGT
GATAACTAGCATTACATGCAAAACCTTGGCTATAATTCAGTTGAATAGAAGGCATTTATA
TGGCCAGAGGAAGTTCAGAGAATTTTTAGCAAGATGACCACTGAGGAACAAAATTTACTT
GGGATTAAGAAACCTCAAAATATGATTATAAAAAGATTAATTGTTTGCCCACCTCCGGTA
AGACCTTCAGTTAGTATGGGTGGTCCTTTCAAATGTGAAGATGATCTTACCTACAGTTAT
TAGAAGATTCTTGTTACTAACAATGTATTGGCAAGAGATATGGACAAAGGTGCTAACTTA
ACAACGTTAAATAAGTTAAGAGAATAACTGTAATTTTATGTGGCTGTGTTAATGGATAAC
GAATGTCCAGGAATACCTACTCACAAACATAAATCAGGAAAACCATTGAAAGCTATAAGA
GCCAGACTAAGAGGCAAAGAAGGTAGAGTTCGAGGAAACTTAATGGGAAAAAGAGTTGAC
TTTTCTGCACGTTCTGTGATAACACCTGATCCAAACTTAGAGCTTGATTAGCTAGGAGTA
CCGATGGCAATCGCTCAAAACGTAACTATCCCAGAAGTTGTAACACCATAGAATATAGAC
GAGTTAAGAAGGCTAGTTGAGAATGGACCTCATCGCTATCCAGGAGCAAAATATATTATT
CGTCATGACGAAAGATAAATAGATATAGGAATATTAAATGAAAGAAGTGATGTGCATTTA
GAGTATGGATATAAGGTGGAACGTCACTTAAGAAATGATGATTATGTACTCTTTAATCGT
CAACCCTCCCTCCATAAAATGTCTATAATGGGACACAGAGCTAAGATACTTCCTTTTTCA
ACTTTCAGATTAAATCTGTCAGTCACATCCCCATACAATGCTGATTTCGATGGGGATGAA
ATGAACATGTTTGTTCCACAATCTTATGAGAGCATGGCTGAAGTCAAGGAAATTATGGCT
GTCCCCAATTAAATTATATCTCCATAATCTAATAAACCAGTCATGGGTATAGTACAAGAC
TCACTGTTAGGTATCATGTTGTTCACTAGGAAAGATAACTTTATTGACAGAAATACAGCT
ATGAATTTAATGATGTGGCTTGGTAAGTACTCAGATAAAGTCTTACCTACACCAGCAGTT
TTAAAACCAAAGCCTTTATGGACTGGTAAGCAGATACTTTCACTTGTAATCCCAGATGTA
AACTTGACTAAATTTTTCGAAGCACCTCCTAAACCTCCTCAACGAAGAAATTGGTGTCCA
ACACAAGAAACTATTGTACTTATTTAAAGAGGATAATTAATCACTGGTCACTTAAACAAG
GCAACTGCAGGATCTTCTTCGTAGGGTCTGATTCATATAATCTGGAAAGAGTGTGGACCT
GATGGTGCAAAACAATTCTTATCAAACGCCTAGAATGTCGTAAATTAGTGGCTAATCGAA
CATGGTTTCACAGTTGGAGTTCAAGATACAATTGCAAGTAAAAAGACAATGGACGGTATT
CATTAGAAGCTCCAACATTACAATAACAAAGTGGCAAGACTTATTTAAAAAGCAGAGCAA
GGCAAGCTGACTACTTAACCTGGTAAGAATATGATGGAAAGTTTTGAGTACTTAGTCAAC
AATAATTTGAATCAAGCTAGAGATGAAGCTGGACAATTGGCATTCAAAGATTTAGATCCT
TGGAATAAGATTCAAAACATGGTGGGTGCAGGATCTAAGGGTACAAATATTAATATTTCA
CAAATTATGGGTTGTGTCGGCTAATAGAATGTTGAAGGTAAAAGAGTTCAATTTGGCTTT
AAATCTAGAACTTTACCTCACTTCCCAAAGCATGATTATGGTCCAGCTTCTAAAGGTTTT
GTCATTAATAATTATATCAGTGGGTTAGATCCTCCAGAATTCTTCTTCCATGCTATGGGA
GGACGTGAAGGTCTTATTGATACAGCAGTCAAAACTTCGGAAACAGGATATATTCAAAGA
AGACTCGTAAAAGCACTGGAAGATATCATGGTAAAATATGACGGTACTGTGAGGAATTCA
GGAGAGTAAGTCATTCAATTCTTATATGGAGAGGATGGAATAGCTGGAGAACACATTGAA
GATCTAAAAATTGATTTACTAAAAATGAGTAATTAAGATGTAGAAAATAAATATGGATTT
ATACCTGAGAGAGTTTCTACAGCTGAAGCAAAAGATTACTTAAGACAATCTATGGATGAC
GGTATGGTGAGTATCATAATGGACAATCCAAATCATCAAATGCAATTAAATAAAGAAAAG
AAACAAATATTACTAGACAGAGATGAACTAAGGACTAGAATTTTGAAAAATGGGGATGAT
TAAATTCACTTACCAATCAACATGAAAAGACTTTTGCTAAACACACACCATCAGTTTAAT
ATAAAAAAGAACAGAATAACTGATCTAGAGCCTATTTATGTCGTAAACTAAGTATAGACG
CTAATGGATGACTTGACAGTTTTCCCAGGAAGAAAATACAGAGCAAATGACACTCAATTC
AATGAAGCAAATGAAAACTCAACAAAACTAATTAAGATTTATCTCAGATCAGAATTAAGT
TCCAAGAAAATGATTTAATAGGAGAGGTTCACAAAAACAGCTTTTGACTTTTTGATTGGT
GAAATAAAAGCAAGATTTGAGTCATCATTAGTGCACCCTGGAGAGATGGTAGGTTCTATC
GCAGCTCATAGTTTAGGAGAGCCAGCCACTCAGATGACTCTTAACACTTTCCATTTTGCT
GGAGTCTCTTCAAAAAATGTCACATTAGGAGTTCCAAGATTAAAAGAAGTAATTAATGTT
TCTAAGAACATCAGTACACCTATGGTTTCAATTTACCTTCAAGGTTAGCACAAAAAGAAT
GAGAAAACAGTTATGCAAATTTAAGGTTTGATCGAGCACACAAATCTCTCGCACTTAGTA
GAAAGTACTGGTATCTTTTATGATCCAGACCCAACAAAGACAATAATCAAAGATGACCAA
GCTTTGGTTGATCTTTACAATTTAGTTCCAGATTTAAACAATGCATCGAAATGTCCTAGT
CCTTGGGTTTTAAGATTAAGATTAGACCCCAACAAACTTCAGAGCAAAGATATCACAATG
GATTTTATTGATAAAAAGGTTCAAGATACATTTGGTGATTTCATAAGTGTAATGGCAAGT
GACACAAATGCATCCATAAATGTTCTCAGACTTAGATTTAGAGATATTAACGATGAAGAT
GATGCTGATGGGGAAAGCGAATAGGAAACAGCTGTGATGTTTTTAAAGTAGATTGAAACA
CAATTACTTAATGAATTCACTCTGAAGGGTATACCTGAGATAAGCAAAGTATATGCCAAG
AAGTACTAAGAAATAGAATATGATATTAAAACAGGTGTATTCAAGCAAACTTCAGATAAT
TTCATGCTTGAAACTGATGGTGTTGCTTTACAAAAAATTCTCTCAGTAAATAATGTCGAC
TACAAGAAGACAGTATCAAACGACATACTTGAAATTTTGAACGTGTTGGGAATAGAAGCA
GTTAGAATGTCACTAATAAATGAATTAAGGGCAGTTCTAAATTTCTATGGAATTTACGTA
AACTACAGACATTTAAGTACACTTTGTGATGTTATGTGTTAGAGAGGTAAATTAACAGCA
ATTACAAGACATGGAATAAACAGAATGGATTCTGGACCATTAAGAAAGGCAAGCTTTGAG
GAGACTGTTGAGATATTATTAGAAGCTGCAGTTTACAATGAGACAGATCATCTCAAGGGA
GTCACGGAAGCTATTATGCTTGGTTAACTTGCGCCATTAGGAACTGGATCTTTTGATGTA
GTGTTAGATGAAAAAGTAATTGAAGAATATTCACAATAACAAGTCGGAGAAGAGATTCTA
GTTGACATTATGACTCCATTGCAAGACGATGACTATTACTTTGGTCACATCAAAATGCAA
CATCACTAAACACCTTACGTTGATACTACACCCTTGCATAAAGGAGGCATGACTTCAGTT
TATTAACAGACACCCGGAGGAATGTCATAATATGATGCTTCATTCTCACCGGGATAAAAC
TACTAATCGCCTGGCTATCAATCTCCAAATGATTATAATTAAAGTCCAATGAGTCCAGGT
TATAGAATGTAATCACCAATGTATCAAGGAGTATATGGTGGCGGAGATAAATTCACATCA
CCTATATATTAAGCTTACTCATCACCAATATACAATTAGATATCAGATGGTGTAATATCA
CCTCAAAATCTTAGTCCAAACAATGGCGGTCATTCGAATATAACTTAGAGTCCAAATTAT
AGTCCAAATTAAAATTCAAATATAAACTCACCTTTCAATCCAATTGATGGCCCAACTGGT
ATAAGAGGCTCACTTTCACCTTCTTATATGAGTATGAGGAACGGAGGAGGTCCAGGTTCG
CATTTGTCTTCACCTGCAATAAATGGAATGACAAGTCCAAACTATTCACCATAAGGTAGG
GATGGAGCTTATGGATCCTTACGTTCTGGAAACTCCCCAGTTTATTCTCCCACAGGTAAT
GCGGTTGGAGGCTATTCAAATGCTTCACCTCACTATTCACCAACTGCAAGTGTAAATAAT
TATAGTGCAAGCAATATGTACCAAAATGCAGTGAAATCAAACTATTCGCCATCTTACTCT
CCCACTACGCCTGCAGCATTTAGTTCCTCGCCTAAATATGGTTTAAATAAATCACCTCGA
TACTCAATCAGGTCTGGTAACGAAGGAGATGACACTTCAGGAGCTAATTACAGTAATAGC
GCGAGGTAGTCAGCTTCCCTATATATACCATAGAGTCCAGCCTATGCAAGTGCTTCAGCC
TCGGCTTCTTACAAAGGTGGCAACAGCACAAATGGGGGAAGCAGCATTCGTGGAGGCAGC
AGCGTACTTAGCATTGATGATAGTGGGGCATCTAATTAATACAGTATGGCCTAGCCAATT
TACGACCCCACGAATTCCAATGCACTTAATTCACTCATGCTTGAAAGTAGCAATATTAAT
AGTAATATTTCGGGAAGTGGTGTCAATAATGGATTTGATAATGTTGCTAGTGATGGAGAT
TAATAAAAATAATCAGAATGA


>Contig5780.0.g96(protein)
MIITGTKNTHSYIEVKKPSAIEFCLLDQDEILKSSVVSIKNERIYDVNMIPAFEGVNDPR
MGTMDRDRLCFTCKGSQVDCPGHFGHIELAKPVYHRGCLEYIKKILKCLCFSCGKLLYPR
EKDHVDQIMRIKSPKHRFMQIMKHHEKYVFRYCESQNGGCGMKQPKVLKKSLALEVEYFS
DNQHYMQNLGYNSVEQKAFIWPEEVQRIFSKMTTEEQNLLGIKKPQNMIIKRLIVCPPPV
RPSVSMGGPFKCEDDLTYSYQKILVTNNVLARDMDKGANLTTLNKLREQLQFYVAVLMDN
ECPGIPTHKHKSGKPLKAIRARLRGKEGRVRGNLMGKRVDFSARSVITPDPNLELDQLGV
PMAIAQNVTIPEVVTPQNIDELRRLVENGPHRYPGAKYIIRHDERQIDIGILNERSDVHL
EYGYKVERHLRNDDYVLFNRQPSLHKMSIMGHRAKILPFSTFRLNLSVTSPYNADFDGDE
MNMFVPQSYESMAEVKEIMAVPNQIISPQSNKPVMGIVQDSLLGIMLFTRKDNFIDRNTA
MNLMMWLGKYSDKVLPTPAVLKPKPLWTGKQILSLVIPDVNLTKFFEAPPKPPQRRNWCP
TQETIVLIQRGQLITGHLNKATAGSSSQGLIHIIWKECGPDGAKQFLSNAQNVVNQWLIE
HGFTVGVQDTIASKKTMDGIHQKLQHYNNKVARLIQKAEQGKLTTQPGKNMMESFEYLVN
NNLNQARDEAGQLAFKDLDPWNKIQNMVGAGSKGTNINISQIMGCVGQQNVEGKRVQFGF
KSRTLPHFPKHDYGPASKGFVINNYISGLDPPEFFFHAMGGREGLIDTAVKTSETGYIQR
RLVKALEDIMVKYDGTVRNSGEQVIQFLYGEDGIAGEHIEDLKIDLLKMSNQDVENKYGF
IPERVSTAEAKDYLRQSMDDGMVSIIMDNPNHQMQLNKEKKQILLDRDELRTRILKNGDD
QIHLPINMKRLLLNTHHQFNIKKNRITDLEPIYVVNQVQTLMDDLTVFPGRKYRANDTQF
NEANENSTKLIKIYLRSELSSKKMIQQERFTKTAFDFLIGEIKARFESSLVHPGEMVGSI
AAHSLGEPATQMTLNTFHFAGVSSKNVTLGVPRLKEVINVSKNISTPMVSIYLQGQHKKN
EKTVMQIQGLIEHTNLSHLVESTGIFYDPDPTKTIIKDDQALVDLYNLVPDLNNASKCPS
PWVLRLRLDPNKLQSKDITMDFIDKKVQDTFGDFISVMASDTNASINVLRLRFRDINDED
DADGESEQETAVMFLKQIETQLLNEFTLKGIPEISKVYAKKYQEIEYDIKTGVFKQTSDN
FMLETDGVALQKILSVNNVDYKKTVSNDILEILNVLGIEAVRMSLINELRAVLNFYGIYV
NYRHLSTLCDVMCQRGKLTAITRHGINRMDSGPLRKASFEETVEILLEAAVYNETDHLKG
VTEAIMLGQLAPLGTGSFDVVLDEKVIEEYSQQQVGEEILVDIMTPLQDDDYYFGHIKMQ
HHQTPYVDTTPLHKGGMTSVYQQTPGGMSQYDASFSPGQNYQSPGYQSPNDYNQSPMSPG
YRMQSPMYQGVYGGGDKFTSPIYQAYSSPIYNQISDGVISPQNLSPNNGGHSNITQSPNY
SPNQNSNINSPFNPIDGPTGIRGSLSPSYMSMRNGGGPGSHLSSPAINGMTSPNYSPQGR
DGAYGSLRSGNSPVYSPTGNAVGGYSNASPHYSPTASVNNYSASNMYQNAVKSNYSPSYS
PTTPAAFSSSPKYGLNKSPRYSIRSGNEGDDTSGANYSNSARQSASLYIPQSPAYASASA
SASYKGGNSTNGGSSIRGGSSVLSIDDSGASNQYSMAQPIYDPTNSNALNSLMLESSNIN
SNISGSGVNNGFDNVASDGDQQKQSE