Identifiers and Description

Gene Model Identifier

Contig18775.0.g49

Standard Name

RPB1a

Aliases

Contig18775_0_g49

Description

RNA polymerase Rpb1, domain 5

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005389409.997093137033517e-262RNA polymerase Rpb1, domain 2
family protein
SGDYDL140C9.997093137033517e-262RPO21 SGDID:S000002299, Chr IV
from 210561-205360, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18775.0.g49(coding)
ATGAGTAGAATTTCAGGACAAGCTTTTGCTTAGTCATACGTTGAACTACATAAAGTTCGC
GCAGTGCAGTTCGGTCTTCTCAATCCCGATGAAGTCCGCAAGATGTCAGTCGTTAACATC
AATAACGAGAGAACATACGACGATAGAGGTATTCCCAACTTCTCAGGCATAAATGATCCT
CGTATGGGAACTATGGACAAGGAGCTTAGATGCTTCACTTGCAAAGGATCATAAGCTGAT
TGCCCAGGTCACTTCGGTCACATTGAACTTGCTAAGCCTGTATATCACGCCGGTTTATTA
GAATTTATCAGAAAGGTACTCAGATGTGTCTGCTTCTACTGCTCCAAGTTATTGGCAGAG
AAGGAGAAACTCGAAGAGCTCAGAAGAATCAAAACTTCAAGTGCTAGACTCGCAAGAGCA
CTTAAGCTTTGTGATGGCATTAGACTTTGTAAGGAATGCGGACACAAGCAACCAAAATTC
TCTAAGACTGGCCTAAAGATACAAGTAGACTATATGGACGATCAAATTGATGCAGGAAGA
GATAGAAAGCAGTTCTTGCAGCCAGATGAAGCTCACAAAGTATTCGAGAGAATTGACGAA
GAATCATGTACCCTAATGGGATTCTAACCGAAGATATCCAGACCAGAGAACATGATCATC
AAGAATTTGGCGGTAGCCCCACCTCCAGTCAGACCTTCAGTATCTATGGGAAACACAATG
AGGAGTGAAGACGATTTGACTTATTGCTACATTAAGATACTTCAGACTAACATCGCTTTA
TAAACTCAAATCCAAAAAGGTGCAAATTTGACAACAATTAATGTCCTAAGAGATAGTCTC
CAATATTATGTTGCTACAGTGATGGATAATGAAATTTAAGGGTAACCAACCTAAAAGCAC
AAATCTGGAAAGCCCTTAAAAGCTATTCGTTCAAGACTTAGAGGAAAAGAAGGTCGTCTT
CGTGGCAATCTAATGGGTAAGAGAGTCGATTTCTCTGCTCGTACTGTCATTACACCAGAT
CCCATTCTCAGATTAGATCAACTTGGTGTACCGCAACAAATTGCACTAAATCTGACAGTT
CCCGAGACAGTCACTGCAGAGAACATCGATGAAATGAGATATCTTGTCCAAAATGGACCT
ACTTAATGGCCAGGTGCAAAATACATTATTAGACATGATGAAAGATAAATTGATCTCTCT
CAACTCAAGAACAGATCTGACTTACACATTGAACCAGGATTTAAGGTTGAGAGACATCTT
AGAAATGATGATTATGTTATCTTTAACAGATAGCCTTCTCTCCATAAAATGTCTTTAATG
GGACATAGAGTCAAAGTGCTTCCATTCTCAACTTTCAGACTTAATTTGAGTGTCACTACT
CCTTACAATGCTGATTTCGATGGTGATGAAATGAACATGCATGTACCTTAAAGTTACGAG
ACTATGGCAGAAGTCAAAGAAATCATGGCAGTCCCTAACTAAATCGTCTCTCCTCAGTCA
AACAAACCAGTCATGGGTATCGTGCAAGACTCTCTTCTAGGAGTCATGCTTTTCACTTTG
AAAGATACATTCATTGAAAAAGAACTTGTTATGCAGCTACTTATGTGGATCAATTACGAG
GATGATAAGCTCCCACCTCCTGCTATTCTTAAACCAAAGCCACTATGGACAGGAAAACAA
ATATTCTCATTGATCATCCCTGACATTAACATTCAAAAAGTCGGAGAGAGATAGAAAAAA
GGAGAACCAAAGAACCTCATTTGGGATAGTGCTGGAGATAATAACATCCTAATGCGAAAA
GGTGAACTATTATGCGGTAACTTAACAAAAAGTACAATCGGTTCTTCATCTGGAGGTATG
ATCCATGTTATTTGGAAAGAAAAAGGTCCCTATGTCACAAGAGATTTCATGTCAAACACT
CAACTAGTCATCAACAATTGGCTTCATTAACATGGTTTCACAGTCGGAGTGCAAGATATT
ATTGCTAAGAAAGAAATTGTTTAAAAGATCAGAGAGAGTATGGTTATTTTCAAGAAGAAG
GTGCAATAAATTACACAAAAAGCTTAAATGGGAAAACTTAAGACTCAACCAGGTAAAGGT
ATGATGGACTCATTCGAAGCATCAGTCAATCAATGCTTGAATAAGGCAAGAGATGATTGC
GGTAACATGGCCTTGGCAGATCTTTAATCTTGGAATAGACTTAAGGCTATGGTATATGCT
GGTTCTAAAGGTTCTAATTTAAACATTTCCCAAATTATGGCTTGTGTGGGTCAACAAAAT
GTAGAAGGTAAACGTATTCCATTCGGTTTCCACAGAAGATCACTACCTCACTTCTCAAAA
GATGACTATGGTCCAGAAAGCAAAGGTTTTGTGGAAAATTGTTATTTAAATGGATTAACT
CCTCAAGAATTCTTCTTCCATGCTATGGGAGGTCGTGAGGGTCTCATTGATACAGCAGTT
AAAACTGCAGAAACTGGTTACATTCAAAGACGTTTGATTAAGGCTCTAGAAGACGTGATG
GTGAAGTATGATGGAACTGTAAGAACTTCAAAAGAACAGATTATTTAATTCCTTTACGGT
GAGGATGGTATGGCTGGAGAGCACATCGAGGATTTAAGTATCCCACTTCTCAAGATGAAA
AATACAGATGTTCAAACCAAGCACAACTTTTTATACAAACCAAAGGAGAGCATGACTGAT
AATGAACTAGAGCAGCACCTTGCCAAATTTATGGATAATGATATCGCTCACTAAATCATT
CAAGATCCTCATATTTGCTTACAACTTAAGCAAGAATATAACTAAATCCTAAAGGACAGG
GATGATTTAAGATTCAGCATCTTGAAGAGTTAAGAAGATGCAGTACATTTGTCTGTAAAT
GTTCCCAGAATTATTTGGAATGCAAAAGAAATGTTTTCAATCAGACCTCTCTAGAAATCC
AACATTCATCCATCTTATGTGTTAGGCAAACTTCAAACTTTAATGGACGAACTTGCACCA
ATTCCAGGAGTCTGGATTAAAAACGACCCACTCATTATCGAGGCAAATAGAGATTCAACC
TGGCTTTTTAAGATCTATTTGAGATCCCTATTGAATACTAAAGCTGTGATTTAGCAAGAA
AGACTGAGCAAAGAGTCATTCGATTGGATTCTTGGAGAAATCAAATCTAGATTTGAGCAA
GCACTAGTTAATCCAGGTGAAATGGTTGGAAGTATCGGAGCTCAAAGTATGGGAGAGCCA
GCCACTCAGATGACCTTAAATACTTTCCATTTTGCTGGTGTGTCTGCTAAGAATGTGACG
TTGGGAGTCCCCAGACTTAAAGAAATAATCAATGTTGCTAAGAACATCAAAACCCCATCT
ATGAAGATATATCTTGAAGATGAAAATAAATAGGATAATAAGACTGCAACAATGTTCGGT
GGTCGCATTGAGCATACAACTCTTTCACATGTGGTAAAGAGTTCAGCAATCTACTACGAC
CCTGACCCAGAGAGAACCATTGTAAAAGAAGACGAAGCTCTGCTTGCTCTCTACAGAGAT
GTGCCAACTATGGAGATGAGTGAAGGCCGTAGAATGACCTCATGGTTGCTAAGATTTGAA
CTAGACAGCGATAAGATGCAGTTCAAAGATCTCACTATGTCAATGATTGAACAGAAAATC
TAAGAAAACTTCAATGACTAGATCAACGTGATGCACTCAGATGACAATGACGAGAAACTT
ATTCTGAGATTGAGAGTCAATGACATTGAAGATGATGAGGATGACACTACAGTGTGCATG
TTCCTCAAAGACTTCCAGGATAGATTGTTCAATGAACTTGCACTTAAGGGTCTTCATGAG
ATAGGCAAGGTCACTTTCACTAAGTACAATGATGAAGTATTTGATCCAGAAACTGGAGAA
GCAAAATAAGATAAAGACTGCTGGTTGATTGAAACAGATGGTGTAGCACTTCAAAAGGTG
CTTGGTTAAGAAGGCATTAACTACAGAAGAACAGTGTCCAATGATATCATTGAAATCTTG
AAAGTATTGGGTATCGAAGCAGTACGTATGTCCCTGATCAATGAATTGCGTTTTGTGTTG
TCTTCCTATGGTATTTATGTGAACTATCGCCATTTGTCAACTCTTTGCGATGTCATGACT
CAGAGAGGAATCTTGACAGCCATCACCAGACATGGAATTAACAGAGTAGACTCAGGCCCC
TTAAGAAAATGTTCTTTCGAGGAGACTGTTGAAATTTTACTAGAAGCTGCTGTGTTTGCT
GAGACTGATCACCTCAAAGGTATTACTGAGAACATTATTATGGGATAACTAGCTCCTTAT
GGTACTGGCTCCTTTGAAATCACAATTGATCCAGAAGTCTTGAATTCATATGCTTAAGTC
AAACCTGAGGATGACGATCTACAAGCTGGTAATACTCCAATGCATTTGGACTAAGGGTAC
AATGAATTCGTTGGAGATAATGAATACGTAATTAACACTCCCACTTAAGGCAGTACACCT
GCTCCAAATTATGGCGGCATGAGTGAGTACTCAAGCTTTGGCACTCCTAATTATCAAGGT
GGTTTCTCCCCCGGTCCAAACCAAATGGCATCCCCATACGGTACAACACCAGCATACATG
AGTCCTTATGGTGCTGGAACTTCCCCTGCCTACAGAACAGGTCAATCACCAATCTACAAT
ATTCATCAATCCCCTATCTACAATGCGAATGACAACAACATGCCTCAGTCACCAAACCAA
AATGCCTATAGTCCCATCTATTCTCCCACCAATCAAACTAGAGGTATGAGTCCGGGCTAC
AACCCTAGCACAAGCCCTGGATACTACAACTAACCATCAGGCGTTGGTGGTCCCAGCCCA
CTATACTCGAATGCAATTGGTGGCAGTTACTAATCACCTGGTTACAGTCCTACTTCAGGT
GGTGGCCATATGAGTGGTTCCGCAAGCTATTCTCCCACAAATCAAAACTATTCAAGCAGT
CCTCACTATTCTCCAACCACACCCAACTACCAGAATCATTATTCTCCTTCTTATTCACCT
ACTTCCAATGTGATGAGTGGAACCTCTTAGATCAGTGCTTCACCCAGATATCAGATTCAT
CAATCATCCACTTCAAGATATGCAGGTGACTCAGGACATATGAGTAATGCATCTCCAGGT
GGCATGTACAATGCATCATCAAGCATTTACATCCCAGCCTCACCAGCCTACAACTAAAAC
GTCAGCAGCCCAAGTTACAATTCCTCTGGCAGTGCTCCCAACAACAACAATAGATCGACT
ACTGGCCCAACTTACAACGCAGGTGGCAGCCCAATCAACGATGACGAAGAGCAACAACAA
CAGAAATGA


>Contig18775.0.g49(protein)
MSRISGQAFAQSYVELHKVRAVQFGLLNPDEVRKMSVVNINNERTYDDRGIPNFSGINDP
RMGTMDKELRCFTCKGSQADCPGHFGHIELAKPVYHAGLLEFIRKVLRCVCFYCSKLLAE
KEKLEELRRIKTSSARLARALKLCDGIRLCKECGHKQPKFSKTGLKIQVDYMDDQIDAGR
DRKQFLQPDEAHKVFERIDEESCTLMGFQPKISRPENMIIKNLAVAPPPVRPSVSMGNTM
RSEDDLTYCYIKILQTNIALQTQIQKGANLTTINVLRDSLQYYVATVMDNEIQGQPTQKH
KSGKPLKAIRSRLRGKEGRLRGNLMGKRVDFSARTVITPDPILRLDQLGVPQQIALNLTV
PETVTAENIDEMRYLVQNGPTQWPGAKYIIRHDERQIDLSQLKNRSDLHIEPGFKVERHL
RNDDYVIFNRQPSLHKMSLMGHRVKVLPFSTFRLNLSVTTPYNADFDGDEMNMHVPQSYE
TMAEVKEIMAVPNQIVSPQSNKPVMGIVQDSLLGVMLFTLKDTFIEKELVMQLLMWINYE
DDKLPPPAILKPKPLWTGKQIFSLIIPDINIQKVGERQKKGEPKNLIWDSAGDNNILMRK
GELLCGNLTKSTIGSSSGGMIHVIWKEKGPYVTRDFMSNTQLVINNWLHQHGFTVGVQDI
IAKKEIVQKIRESMVIFKKKVQQITQKAQMGKLKTQPGKGMMDSFEASVNQCLNKARDDC
GNMALADLQSWNRLKAMVYAGSKGSNLNISQIMACVGQQNVEGKRIPFGFHRRSLPHFSK
DDYGPESKGFVENCYLNGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKALEDVM
VKYDGTVRTSKEQIIQFLYGEDGMAGEHIEDLSIPLLKMKNTDVQTKHNFLYKPKESMTD
NELEQHLAKFMDNDIAHQIIQDPHICLQLKQEYNQILKDRDDLRFSILKSQEDAVHLSVN
VPRIIWNAKEMFSIRPLQKSNIHPSYVLGKLQTLMDELAPIPGVWIKNDPLIIEANRDST
WLFKIYLRSLLNTKAVIQQERLSKESFDWILGEIKSRFEQALVNPGEMVGSIGAQSMGEP
ATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVAKNIKTPSMKIYLEDENKQDNKTATMFG
GRIEHTTLSHVVKSSAIYYDPDPERTIVKEDEALLALYRDVPTMEMSEGRRMTSWLLRFE
LDSDKMQFKDLTMSMIEQKIQENFNDQINVMHSDDNDEKLILRLRVNDIEDDEDDTTVCM
FLKDFQDRLFNELALKGLHEIGKVTFTKYNDEVFDPETGEAKQDKDCWLIETDGVALQKV
LGQEGINYRRTVSNDIIEILKVLGIEAVRMSLINELRFVLSSYGIYVNYRHLSTLCDVMT
QRGILTAITRHGINRVDSGPLRKCSFEETVEILLEAAVFAETDHLKGITENIIMGQLAPY
GTGSFEITIDPEVLNSYAQVKPEDDDLQAGNTPMHLDQGYNEFVGDNEYVINTPTQGSTP
APNYGGMSEYSSFGTPNYQGGFSPGPNQMASPYGTTPAYMSPYGAGTSPAYRTGQSPIYN
IHQSPIYNANDNNMPQSPNQNAYSPIYSPTNQTRGMSPGYNPSTSPGYYNQPSGVGGPSP
LYSNAIGGSYQSPGYSPTSGGGHMSGSASYSPTNQNYSSSPHYSPTTPNYQNHYSPSYSP
TSNVMSGTSQISASPRYQIHQSSTSRYAGDSGHMSNASPGGMYNASSSIYIPASPAYNQN
VSSPSYNSSGSAPNNNNRSTTGPTYNAGGSPINDDEEQQQQK