Identifiers and Description

Gene Model Identifier

Contig15041.0.g92

Standard Name

RPB12

Aliases

Contig15041_0_g92

Description

DNA directed RNA polymerase, 7 kDa subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam03604 ) DNA directed RNA polymerase, 7 kDa subunit
  • ( pfam07376 ) Prosystemin
  • ( pfam01155 ) Hydrogenase expression/synthesis hypA family
  • ( pfam09963 ) Uncharacterized protein conserved in bacteria (DUF2197)
  • ( pfam12773 ) Double zinc ribbon
  • ( pfam10058 ) Predicted integral membrane metal-binding protein (DUF2296)
  • ( pfam10080 ) Predicted membrane protein (DUF2318)
  • ( pfam05810 ) NinF protein
  • ( pfam07282 ) Putative transposase DNA-binding domain
  • ( pfam09297 ) NADH pyrophosphatase zinc ribbon domain
  • ( pfam10571 ) Uncharacterised protein family UPF0547
  • ( pfam14446 ) Prokaryotic RING finger family 1
  • ( pfam06061 ) Baculoviridae ME53
  • ( pfam04828 ) Glutathione-dependent formaldehyde-activating enzyme
  • ( pfam09723 ) Zinc ribbon domain
  • ( pfam09855 ) Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082)
  • ( pfam01096 ) Transcription factor S-II (TFIIS)
  • ( pfam13719 ) zinc-ribbon domain
  • ( pfam13542 ) Helix-turn-helix domain of transposase family ISL3
  • ( pfam12760 ) Transposase zinc-ribbon domain
  • ( pfam13248 ) zinc-ribbon domain
  • ( pfam13717 ) zinc-ribbon domain
  • ( pfam08792 ) A2L zinc ribbon domain
  • ( pfam01907 ) Ribosomal protein L37e
  • ( pfam13408 ) Recombinase zinc beta ribbon domain
  • ( pfam13240 ) zinc-ribbon domain
  • ( pfam02591 ) Putative zinc ribbon domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYHR143W-A 149.7

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15041.0.g92(coding)
ATGAACACTAGAGGAGGACTGAACACCAGCATGGACATCGACAATTCTGGACTTCATGAC
ATCAACGAGGAGGACATGGAGAGCAGAGAGAAGCCCAAGGTCACCTACATCTGTGGAGGT
TGTGGAAAGGACAACAAACTCGACAAGGACTCAGTGATCAGATGCAATCACTGCGGTCAC
AGAATCTTCTACAAGAAGAGAGAAAGAAAGCTACTTCAATATGAGGCTAGATGA


>Contig15041.0.g92(protein)
MNTRGGLNTSMDIDNSGLHDINEEDMESREKPKVTYICGGCGKDNKLDKDSVIRCNHCGH
RIFYKKRERKLLQYEAR