Identifiers and Description

Gene Model Identifier

Contig11798.0.g106

Standard Name

RPB11c

Aliases

Contig11798_0_g106

Description

RNA polymerase Rpb3/Rpb11 dimerisation domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam13656 ) RNA polymerase Rpb3/Rpb11 dimerisation domain
  • ( pfam01193 ) RNA polymerase Rpb3/Rpb11 dimerisation domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOL005C0.00000000000040012475857291343RPB11 SGDID:S000005365, Chr XV
from 316175-315813, Geno...
T. thermophilaTTHERM_000117600.00000000039982266684865623RNA polymerase Rpb3/Rpb11 dime
risation domain...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11798.0.g106(coding)
ATGTCAGATATCCTTGCCAACCAGAAGTTCATCTACACAGACGACAACAGAGTGAGACAC
CAGGGCACTTTGACCATCAAGGATGAGGACCACTCACTCGGTAACCTCGTTAGACAGCAA
CTCCTGCACAACCCCAAAGTCAAGTTCTCAGGCTACAGGAAACCACATCCACTCGAGGAG
TACGTAGAGATCAAGGTGCAGACCACAGGAGAGGTATCCCCACCAGACTCTATCATCATG
GCTAGCGAGCAGTTGTTGAGCCAAATGAAATCTCTTAGTGACAGTTTGATGAAGCAAGCT
CAACTCCTCAGGGTCATGGACAACTCAAATACCTACCCCAATTGA


>Contig11798.0.g106(protein)
MSDILANQKFIYTDDNRVRHQGTLTIKDEDHSLGNLVRQQLLHNPKVKFSGYRKPHPLEE
YVEIKVQTTGEVSPPDSIIMASEQLLSQMKSLSDSLMKQAQLLRVMDNSNTYPN