Identifiers and Description

Gene Model Identifier

Contig13770.0.g40

Standard Name

RPB10b

Aliases

Contig13770_0_g40

Description

RNA polymerases N / 8 kDa subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01194 ) RNA polymerases N / 8 kDa subunit
  • ( pfam05864 ) Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide (RPO7)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR210W2.000470901975128e-28RPB10 SGDID:S000005736, Chr XV
from 738320-738532, Geno...
T. thermophilaTTHERM_005221802.0009605191578312e-25RNA polymerases N / 8 kDa subu
nit family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13770.0.g40(coding)
ATGATCATTCCTGTTAGATGCTTCACCTGTGGCAAAGTTGTTGGCAACAAGTGGAACAAG
TACCTTGACTTGCTTGAGCAAGATGGTTGCACTCCTTGCAAGGCACTAGATGAGCTCGGA
TTAAAGAGATACTGCTGCAGAAGAATGGTCCTCACCCATGTTGATTTGATATCAAAACTC
TTGAACTACAACATCTATGAACATGAGAGAGATTGA


>Contig13770.0.g40(protein)
MIIPVRCFTCGKVVGNKWNKYLDLLEQDGCTPCKALDELGLKRYCCRRMVLTHVDLISKL
LNYNIYEHERD