Identifiers and Description

Gene Model Identifier

Contig1318.0.g86

Standard Name

RPA43

Aliases

Contig1318_0_g86

Description

SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam03876 ) SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009927400.000008000552149328928hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1318.0.g86(coding)
ATGTCTCACGATCACTTATTTAAGGAGTCTCAAGTCATTGACAAGATAATGCTTCACCCT
AGTGATACAGTGAACATTAAGCACTCAATCATGAAAGAATTAAACAAAAAGCTAATGAAA
TGGGATGATCAAGTCAGGGGTGTTTTTGTGTCCTTTTAAAATGTACAGATTTTGAATGGA
GGAAAGGGAAGGATAATGGACGATTTCGCATGGATTCAATATAATGTTAGATTCACAGTT
ACCTATGCTCAACCTAAAATTGATGATAGAATTTACGGAACTGTCAAGGACATCTAATTA
GGCCATATGACTCTTTCAGTCTACAACATATTGACAGTTATCGTAAATCTAGAAAGTTTG
GACTCAAAGAGATTCCAAATACAAAATACAGCATCAGCTATCCTTAGCGACATTGAATCA
AATGCTGAAGATGATTTCGATATAGAAGATTAAAAGAGCAAGATTGAAATTTCAGACAAG
TAGAATGGAACCACACATAAAGTCGATTCAATTGTTGAAATTTAAATAACAAAGTTGAGC
ATAAGTCAAGGCAATGTTATTTTATTTGGACAACTAGTTTGA


>Contig1318.0.g86(protein)
MSHDHLFKESQVIDKIMLHPSDTVNIKHSIMKELNKKLMKWDDQVRGVFVSFQNVQILNG
GKGRIMDDFAWIQYNVRFTVTYAQPKIDDRIYGTVKDIQLGHMTLSVYNILTVIVNLESL
DSKRFQIQNTASAILSDIESNAEDDFDIEDQKSKIEISDKQNGTTHKVDSIVEIQITKLS
ISQGNVILFGQLV