Identifiers and Description

Gene Model Identifier

Contig713.1.g94

Standard Name

RPA3

Aliases

Contig713_1_g94

Description

Replication factor A protein 3

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig713.1.g94(coding)
ATGTCAGACGAGGTAAAAGCAGTGCACAGAGAGCCCCATCCATTCATTGGTCTCAATCAC
ATCGCTCATTTCGTGGGCAAGCCAGTCGCATTCGTTGGCAAAGTCGATAGAATCGAGGAT
AGCACCATGTTCCTCAAAACTGCAGAGGACAGAGAAGTGAAGATTATCAAGTTCAGAGGC
GACGCATCCAAGATGAGTGGAAACATCGAAGTGAGAGGCATTGTGAACAAGGACGGAACT
ATCAGCTATGGAGAATTCACTCAATACGACAACGAGTTTGATCTTGGTACTCATGAACAT
ATGCTAGAATACTACCACGGTATGTGCAAGGAACTCTGCGTAAGATCTAACTGA


>Contig713.1.g94(protein)
MSDEVKAVHREPHPFIGLNHIAHFVGKPVAFVGKVDRIEDSTMFLKTAEDREVKIIKFRG
DASKMSGNIEVRGIVNKDGTISYGEFTQYDNEFDLGTHEHMLEYYHGMCKELCVRSN