Identifiers and Description

Gene Model Identifier

Contig11466.0.g109

Standard Name

RPA2d

Aliases

Contig11466_0_g109

Description

OB-fold nucleic acid binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam01336 ) OB-fold nucleic acid binding domain
  • ( pfam08784 ) Replication protein A C terminal

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11466.0.g109(coding)
ATGTTTTCTTCCACAAATACTTAACAAGGTTTCTTCCAAGTAAACCATAATCAATACTTC
GAAAATAACTAGCCTAGAAACTAGATATTCACAAATAACTCTTTGAACTAGAGTTACTAG
GGCTACGGCATAAATTTAAACTCACATAGGAACATAGTTTCACAAAATAAGAAAAAGCTG
TACATACCTGTAACTTGCAAATAGCTGAGGTAAATGCCAGTTGATATGGACGATATATGT
CTAATGAATGGGGATCAAGTTTAAGAAATTGTAATAATAGGAAGGACTATGTCTTGCAGA
GAGGACTCGATGCGATTCACACTAGAAATAAACGATAGTACTGAAATATTCAAAGTGGTA
TTCTTCTAGAAAGATCCCTTTTAGTCTCCTTTTCCAGCAGACTTCAAATTTCAAGAGAAC
ATTTATGTGAAGATATTTGGCACAATCAGAGTATACAAGGAAGAGAAAGCCATTATAGGG
TCATACATTAAGAATCTAGTTAAGAGTGATGAAATCACTAATCACCTCTTGCAAGTGTTT
TGCTCTGAGCAGCTAAGATAAAAAGGAGTTCTCAAAGATTTTACTTAATCTTCCTAACAA
AGTCCTCTTATCAAACAAAAACAGACAATGCAAGGTGATCATAATACAAATTCTAAAGCA
AATTGCCAAAATAGAAAAAGTTTAACATAATCCAAACTAGATCCGCTTGTAGGCAAGGAT
AAATATTTCAAAGAAATCAGCAACTAAATTTTAGAACTAATGCTTGAAATGAGAAGTGCT
TGCAGGGAGATGCACAAAGACGATATTATTCAAGTTTTAGATCGGTAATTTTAACCTAAA
GATATAAAGCAGGGAATGAGAACACTAGTTGAGAATGGGCTAATTTTGAGACATCCAAGA
AACTTAAATGTATATAAATTATCTGATGTGAATTAATTTTGA


>Contig11466.0.g109(protein)
MFSSTNTQQGFFQVNHNQYFENNQPRNQIFTNNSLNQSYQGYGINLNSHRNIVSQNKKKL
YIPVTCKQLRQMPVDMDDICLMNGDQVQEIVIIGRTMSCREDSMRFTLEINDSTEIFKVV
FFQKDPFQSPFPADFKFQENIYVKIFGTIRVYKEEKAIIGSYIKNLVKSDEITNHLLQVF
CSEQLRQKGVLKDFTQSSQQSPLIKQKQTMQGDHNTNSKANCQNRKSLTQSKLDPLVGKD
KYFKEISNQILELMLEMRSACREMHKDDIIQVLDRQFQPKDIKQGMRTLVENGLILRHPR
NLNVYKLSDVNQF