Identifiers and Description

Gene Model Identifier

Contig8654.0.g14

Standard Name

RPA2c

Aliases

Contig8654_0_g14

Description

OB-fold nucleic acid binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam01336 ) OB-fold nucleic acid binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8654.0.g14(coding)
ATGTTTTCAGATAGAGGAAACGGAGGTGCTGGGCAGGGCAACGACTATGGCAATAATAAT
AATAGCAACAATGCGGAATAAACCAATAATTTCTCAAGTGGCATGTCTCAAAGATCAAAT
AACTACAACCAGAAAAGGTATGGGCAATATAACAGTTTTAAGGGTGGTGGCGGAGGTTAA
AGATTTAATAATTATGGAGGAGCTCAATAAGATCGATTTAATGGAAACAATAATTAAAAC
AGCAATTTTAACAATAATTAACAAGCATTCTCGCCATTCAAGAGTAATAACCCAGCCTAT
CAAGAAATTAGTGCCATTCAGACAGGTAACAATAATAACTAAAAGGAAGCTTTATCTCAC
AATGAAAATTAAGCAACTTCGAATTAGTTTTACAATCCTTTCAATCATAGTATTCCATCT
ATAAAATAGAAGCCACCCTAGTCTCATGCTGAATACAGTTAGTAAGTGAAGAAATCAAAA
ATTTTTGTTCCTGTTACATTGAAAATGGTCCAAGAATGTGGGGCAAGACATGATGATGTA
TGTGAATTTGACGGTGATGTTATTTGTAATATTGTAGTTTTGGGGAGATTAATTCAAAAA
AGAACTGAGCCTTAAAGAACTTAATTTGAAATCAATGATACCACAAGCAGTTTCAGAATC
CTTTTTTATCATAAAAGTGAGTCGGAGCAACCAGAAATGATTAGAAAATTAAATGCCAAG
CCATTGCAAGATTACGTGAAGATTTTTGGCTAGATTTAGGTATTTAAAGATTAGAAAGCT
ATTATTGGTGCATTTATAAGGCAAGTTAACAGTTCAGATGAAATAACAAATCATTTCTTG
TCTGTATTTACGTCCCATTAAATCAGGAAAAATGGAGCACTTAAACCAAGTGACTTAGGC
ATAGAACCTGCTCCTAGGGTATACTCATAAGGTGGGTAGAGTACTGCATACAATAGCAAT
TAAGTAAGTAATGATTAACAAATGTGGACTAATAGCTAAAACAGAAAAGAGAGTTACTTT
GAGTAAAAATGCAACTACTAGAACAAAGGTCAATCCCCAATTAATAAACAAGAATATCAG
AGTAATAGATAGTACAGTGGGAATAATTATCATTCTAACCAAAATAGCAGCAACAGTGGA
GGAGGATATAATTATAGCTAATACACTAAGAATTAGTAGTTTTAGTAATCTTAAAATTCT
GGTACACCTCGAACTTTCAATAATATTTTGAGCAACAGCTATAACAAAGATACCTAATCA
AATTAGAATAGAGTTTTCAATGACTCCTATAGCAACAATTAGTCAACTTATTGCTCAAAT
AAAAATTCTCCACACTTCGGTCCATCATCTGGTTAGGACATTATGAAGCCATAAAATCAT
ATGTAGCCACCATAATTTAACTGA


>Contig8654.0.g14(protein)
MFSDRGNGGAGQGNDYGNNNNSNNAEQTNNFSSGMSQRSNNYNQKRYGQYNSFKGGGGGQ
RFNNYGGAQQDRFNGNNNQNSNFNNNQQAFSPFKSNNPAYQEISAIQTGNNNNQKEALSH
NENQATSNQFYNPFNHSIPSIKQKPPQSHAEYSQQVKKSKIFVPVTLKMVQECGARHDDV
CEFDGDVICNIVVLGRLIQKRTEPQRTQFEINDTTSSFRILFYHKSESEQPEMIRKLNAK
PLQDYVKIFGQIQVFKDQKAIIGAFIRQVNSSDEITNHFLSVFTSHQIRKNGALKPSDLG
IEPAPRVYSQGGQSTAYNSNQVSNDQQMWTNSQNRKESYFEQKCNYQNKGQSPINKQEYQ
SNRQYSGNNYHSNQNSSNSGGGYNYSQYTKNQQFQQSQNSGTPRTFNNILSNSYNKDTQS
NQNRVFNDSYSNNQSTYCSNKNSPHFGPSSGQDIMKPQNHMQPPQFN