Identifiers and Description

Gene Model Identifier

Contig1943.0.g11

Standard Name

RPA2b

Aliases

Contig1943_0_g11

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1943.0.g11(coding)
ATGTTCTAAGATAATAACGTCGGTACTGGTTTTCACCTGCAACCTCAAGGCTTCCTAAAC
GAAAACAATCAAGGAAATGGTGGCGGTGGTGGAAATAGCATGTACGGGTAGAATAATGGC
AGAAGATACATGGGAAACGATCAACCAAAGAAGTCTAAGGTGTTCACTCCAGTAACTCTT
AAAATGGTTTAGTAGTCACAACCAAGACCTGATGATCAATGCGAATATGATGGAGATACT
ATCAACGACATCATTATAGTAGGCAGAGTGCTCAAGAGAATCGAGGAACCTATGAGGACT
CAATTTGAGATTAACGATAATACCTGCACTTTCCATGTACTGTTCTATCATAAAGGAGAG
AATCAAGTACCAACTGCGCTCAGAAACTTCAACTTTGAGCAGTTCACTTATGCAAAAATC
TACGGCAACATCAGAGTATTTAAAGAAGAGAAGGCTATCGTTGGAACTCATATCAAGCGA
ATTGAGAAGTTTGATGAAGTGACCAATCATTTCCTATCGGTTTTTATCTCAAACTGTATT
AGAAAGAAGGGCATATTAAAGCCCAGGGAGCTAGCAATGGAACAGCCTAATAACTTGAAC
ATGCCAGTGAATGCGGGAAACGAAAACTAAATGCAAGTAGATTCACATCCCTAACAATAG
CAGCAGCAATAGCAACAGTAGTAACAGCCCTCATACAGCAACAATAATAACTATCAAGGT
GGATACAACAGAGGGAATGGTGGTTACAACAACAACTACAATAACAACAATGGAGGAAAC
GGAGGAGGTGGCTATAAGAACAACTACAATAACAATCGCTACAATAACAACAAAAATAAC
TATAACAACAACAACCAAAACTCGCACTATAACAACAATAGTAACTACAACAACAATAGC
AACAACCAGAACAACCATCACCAAAATGATAATGACCACGGAAACCACGGAGGAAATGAT
GAAGAACTTAAGAACAACGTTCTAAATCACATTAAGAGTTTGCTGTAGAACAATAAATTT
GCTTAGAAGGATCAGTTGAGGCAGATGCTTGGGAATAGCTGCAGAGACGACTAGAGATTT
GAGAAAGCGCTTATTAGTTTGCAGAATAATGGAGAGATCGTTTAGGGGCATGATAATAAC
ACTTTCTTGTTGGTATGA


>Contig1943.0.g11(protein)
MFQDNNVGTGFHLQPQGFLNENNQGNGGGGGNSMYGQNNGRRYMGNDQPKKSKVFTPVTL
KMVQQSQPRPDDQCEYDGDTINDIIIVGRVLKRIEEPMRTQFEINDNTCTFHVLFYHKGE
NQVPTALRNFNFEQFTYAKIYGNIRVFKEEKAIVGTHIKRIEKFDEVTNHFLSVFISNCI
RKKGILKPRELAMEQPNNLNMPVNAGNENQMQVDSHPQQQQQQQQQQQQPSYSNNNNYQG
GYNRGNGGYNNNYNNNNGGNGGGGYKNNYNNNRYNNNKNNYNNNNQNSHYNNNSNYNNNS
NNQNNHHQNDNDHGNHGGNDEELKNNVLNHIKSLLQNNKFAQKDQLRQMLGNSCRDDQRF
EKALISLQNNGEIVQGHDNNTFLLV