Identifiers and Description

Gene Model Identifier

Contig22204.0.g75

Standard Name

RPA2a

Aliases

Contig22204_0_g75

Description

Replication protein A C terminal

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam08784 ) Replication protein A C terminal
  • ( pfam01336 ) OB-fold nucleic acid binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYNL312W0.000000600201742947405RFA2 SGDID:S000005256, Chr XIV
from 48287-48293,48402-4...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22204.0.g75(coding)
ATGTACACAGACAATTAAGGTGGATTTTTCAATCATGGAGGCTTCGGAGGAGGCAACAAC
TTCGGCGACTCAAACAAGAAGGGAAACTATGGAGATAACAACAGATCAGGCAACAATGCT
GGTGGAAACGACCAGGCCCGCAAAAAGAGATTGTTCACTCCAGTCACAATCAAAATGCTG
ACAGACGCCGCTCTAGGACCCGATGATACTTGCGAGATTGATGGAGAAATGATTCAAGAT
ATCATTATTGTTGGCAGAATTATTGCAAGAACTGAGGAGTCTATGAGAATTTAATTTGAA
GTCAATGATAGCACTGGCACATTCAAAATCATATTCTATAAGAAGGACGCCAATATGATC
CCTACTGCTCTTAAGAACTTCGAATACACTCAATTTATGTATGCCAAGATTTTCGGTACA
ATTAGAGCTTACAAGGAAGAGAAAGGTATTGTTGGTACTCACATCAAGAAAGTTGAGAAG
TTTGAAGAGATGACAAACCATTTGTTGCAAGTATTCGTAGCCAACCAAATGAGATTAAAG
GGTGTCCTCTCTCAACAAGACTTCGTGAATGATCAAGTTGGCAAATAAGCAGCTTTAGGT
CAAAGTCAAGGCAACTAAAATAGCAAGGGAGGCATGTCCATGGGTTTCTCTGGCAGTGGT
GACTTGAAGGATATGATTCCAGCTATTATGACTGAGATGTCAAAGTAAACAAAATTTATT
CACAAAAAGGATATCTACTCCATGCTCTAAAACAAATACGATGAGAACACTTATGAGAAC
ACCTTACAAAGATTGTGTGATGATGGTGTGATCTACACTACCTATGACAAGGACGTTTAC
TCTTTAAATGAAGCTTGA


>Contig22204.0.g75(protein)
MYTDNQGGFFNHGGFGGGNNFGDSNKKGNYGDNNRSGNNAGGNDQARKKRLFTPVTIKML
TDAALGPDDTCEIDGEMIQDIIIVGRIIARTEESMRIQFEVNDSTGTFKIIFYKKDANMI
PTALKNFEYTQFMYAKIFGTIRAYKEEKGIVGTHIKKVEKFEEMTNHLLQVFVANQMRLK
GVLSQQDFVNDQVGKQAALGQSQGNQNSKGGMSMGFSGSGDLKDMIPAIMTEMSKQTKFI
HKKDIYSMLQNKYDENTYENTLQRLCDDGVIYTTYDKDVYSLNEA