Identifiers and Description

Gene Model Identifier

Contig15857.0.1.g57

Standard Name

RPA1g

Aliases

Contig15857_0_1_g57

Description

Replication factor-A protein 1, N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam04057 ) Replication factor-A protein 1, N-terminal domain
  • ( pfam01336 ) OB-fold nucleic acid binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYAR007C4.9998290395614495e-40RFA1 SGDID:S000000065, Chr I f
rom 158619-156754, Genome...
T. thermophilaTTHERM_001068900.000000000007996637300921877hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15857.0.1.g57(coding)
ATGAAGAAAATAGATAACTACGGATTTGCGACTACTTTTTAGAGTTTGCAAGATGATGTC
GAGAATAATGAACACAATCAGAATTATGATTAATAAAATTACAATGACTGCGATGAAGAC
ACAGGTATGAATGAATACAGACCCTAGGCATAAGGAGCAAAGTAACAGGGCAAGGCAGGC
TACAATTTCATGCGTTCTAATAAGAAATTTCACCAGAAAAATTCACCTAAGGGTTTCAAC
CCAAACAGCCAGGCAAAACCAACACCAAAGAAAGTAGAGAACAATCTAGCAAGGAAGAAG
TTTACTGCCAATCAAAATACAACTACAAATAATGCTGGAAATAATGGGACTACTGGAAAT
AACTAAAGTAGTTACTAGTAGAAACCTAGTGAAGCCAATAGTACTACTAATTAATAACAG
GAAAGTGGGTGTATTAAGAATAATAATAATACCAATAGTGGAAATAACAGCAATAACAAC
ACTAGCAGTGCCAACTCTTCACAGACGAAAAATAGTTGGAAAAATCTACCTAAAAAACCC
CAAAACCCCTCAAACTCCAATTAATCTTACTCTTCCTCCTACAACTATAACAATAACTTC
AGCACCTATGGAAATAACAATGGAGGTTATAGTAACTTTAATAATTTCGGGTATGGCTAG
TAAAAAACAGGGGCACAGAAGATATACATGACGTTGACTGCTGATGGAGTCAGTAAACTA
GTGCATATGGGTTAGTAAGCGCAGAGTAATAACAACACAAATGGAAACAACAATAATAAT
AGTGTGTTTGAGTTAGAAACCACCAATAAGGCTGATAAGGATATCATCGTGCAAGTAATC
CTAGTGAAATATGTAAAAGATCATAAAAACATGAAAGCAAGAATAATGATATCTGATGGT
CACTGGGCTGTGTAGGCTATCATTAGCCATGAAATTCACAACAAAATGGAAACAAAAGAA
ATATAGAAGTATGACATTCTAAAGATCAGTAAATGCTTTACTAAGGGCATAGATAGCAGT
TCCATCATATTGGTATTACTGAGTCCACCTGTAGTGATCTACACAGATATAAAAAGCACC
CTAGGGAATATTGACGAATTAACTGTAACTTAGTTAAACTTATTCACCAACAAGGCCTCA
AACACCTCCTCCAAACCTCAACCTGTAAAGATCCCAAACTCTGTGATACTCTCACATACT
AATATTTAAGAATTCGAGTTGGTGTTTTAAGATGGTGGATGCATGCCTATCGCTAAGCTA
GCACCTTATATGGGTGGTAGATGGAGAATTAAAGCTAGATTGATTAAAAAAGGGGATAGA
AGGTCATGGAAGAGCGATAAAGGTGAAGGAACATTGATGAATGTTGAACTTATAGATGAA
GAAGGTACAATGATATAGGGCACATTCTTTTAAGATGTTGCTGATAAATTCTGCGACATG
TTGGTAGAAAACAAAGTTTATTTAATGACTGGTGGTCTTATAAAAGAATCAAGACCACGG
TTTGCAAGTGTGAAACATGATTTCTGCATAGTTTTTGACAAATTTTCAGAGATATCAGAA
ATAGATGATGATGGTACAGTTGCTCAAGAGAAATCTAAAGCTGGCTTTAATTTCGTTTCA
ATTGATAAAATAGCAGAAATGAACCCTATGGAGTCTGTAGACATAATTGGAATAGTTTAT
ATGGTAGGACCAGTAGGCACAGTTTCACTGAAAAGTGGTGAGTTTAAGTAACGAAGAAAT
ATTCTTATTTGTGATGACACAAACTTAACTATATGTGTTTGCTTTTGGGGAGATAAAGCG
AGTTCACATGACTTTTCTGGTCACCCGGTTGTGGCTGTAAAAAATGCTAAAGTCAGTGAT
TTTGCTTCAAAGAGTTTAAATGCCAACGAGGACTCAGCCGTGTTCTTTAATTGTCAGTTT
GAGAAAGCAAAGGAAATGAGAGCCTGGTATGACGGGTTATCAGGATCAGACGATAATTTT
CATCCACTCTCAACAGGTACAGGACTTGAGAATATGATGAAAGAACCTCCTAAAGATGAA
ACATTGCATAGATTTTGTTAGCCTAGTGCCTCTGGTCTAAAAGTAAATCCTGAAGAAGGC
AACACAATTGATTAAGATTTAGAGATGCAAGAAGGCGATGAAAATTAAGACACTGACATG
ATAGAAAGATCGATATCCCCAAATGAAATTAGAAAAAAGTTATTTGAAGAACGTAGGAAA
AGTTTTGCAAGAAAATGAGCTAGTAGTGGTATTGGAGAAGAAAGAATAGTTTAAATGGAG
CTTGCAAGATCAATGGCAACTAGAGCTAGGAAGCGTGGTAGAAAGCCAAAGCAACAAGAA
AGTGCACTGGGCTTACCGCAAGAGTTCAAATATTCATCAAACCAAAACAACCACAACTAT
CATAATCAATACAACAATAACTATAACAATAATAATGGGGGAGGAGGCCACGGAGGAAGC
TTTAATGGATTTAAAAAGAGAGGCAGAAAAGGCAAGAGCGAAGGTGGAAATAATGGAGGA
GGATCTGGATTTGGTGGAGGTATACCAGGTGTTGATCCCTAATGA


>Contig15857.0.1.g57(protein)
MKKIDNYGFATTFQSLQDDVENNEHNQNYDQQNYNDCDEDTGMNEYRPQAQGAKQQGKAG
YNFMRSNKKFHQKNSPKGFNPNSQAKPTPKKVENNLARKKFTANQNTTTNNAGNNGTTGN
NQSSYQQKPSEANSTTNQQQESGCIKNNNNTNSGNNSNNNTSSANSSQTKNSWKNLPKKP
QNPSNSNQSYSSSYNYNNNFSTYGNNNGGYSNFNNFGYGQQKTGAQKIYMTLTADGVSKL
VHMGQQAQSNNNTNGNNNNNSVFELETTNKADKDIIVQVILVKYVKDHKNMKARIMISDG
HWAVQAIISHEIHNKMETKEIQKYDILKISKCFTKGIDSSSIILVLLSPPVVIYTDIKST
LGNIDELTVTQLNLFTNKASNTSSKPQPVKIPNSVILSHTNIQEFELVFQDGGCMPIAKL
APYMGGRWRIKARLIKKGDRRSWKSDKGEGTLMNVELIDEEGTMIQGTFFQDVADKFCDM
LVENKVYLMTGGLIKESRPRFASVKHDFCIVFDKFSEISEIDDDGTVAQEKSKAGFNFVS
IDKIAEMNPMESVDIIGIVYMVGPVGTVSLKSGEFKQRRNILICDDTNLTICVCFWGDKA
SSHDFSGHPVVAVKNAKVSDFASKSLNANEDSAVFFNCQFEKAKEMRAWYDGLSGSDDNF
HPLSTGTGLENMMKEPPKDETLHRFCQPSASGLKVNPEEGNTIDQDLEMQEGDENQDTDM
IERSISPNEIRKKLFEERRKSFARKXASSGIGEERIVQMELARSMATRARKRGRKPKQQE
SALGLPQEFKYSSNQNNHNYHNQYNNNYNNNNGGGGHGGSFNGFKKRGRKGKSEGGNNGG
GSGFGGGIPGVDPQ