Identifiers and Description

Gene Model Identifier

Contig9697.0.1.g33

Standard Name

RPA1d

Aliases

Contig9697_0_1_g33

Description

Replication factor-A C terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam08646 ) Replication factor-A C terminal domain
  • ( pfam01336 ) OB-fold nucleic acid binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYAR007C0.0000000029989608248573072RFA1 SGDID:S000000065, Chr I f
rom 158619-156754, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9697.0.1.g33(coding)
ATGAAATTGAATAAGTTTCTGGCGAAGAATATTCCATACGATACTGAGTATGATATTCCA
TAGATTCCTGCGATATAAGAGCAAGTGGTTCAAATTTAAGGGGACTAAGAGGAGGAAAAA
ATGGAGAAATTTTGTAATGCAGAAGACCAGCACTCTCAAGGCTCCTATCAGAGAGATTAA
GATGGTTCAAGCGGTCAACACACAGCTTTAATTCAAATACCCTCTCCTCAAAAATCTGTG
AGCAATTTGCAACTTGAGTCTCAATATCAATCACAATTTACATAGATAAATAGACCCTTG
AATTTCGGATAATCTCAAAATCAAACACAGCAATACTCTTAATATTAAAATCGAGCTTAA
AATTACTTCTAAAACAGACAAGAGAGAAATTCTACAATTATCGATTCTAAATACATGCCA
ATTAAAGCCTTGAACACTTTCTCCCGAGATTGGTAAATTTAAGCAAAGTTAGCTAGGAAA
AGTGAGCTCAGAGAAACTCAAAGATAAAAAACAGTAGTTCTTAAGATTGAAATAATTGAT
GTTTTCGGGACAACCATAGAATGTACATTTTTCGCGGATGCAGCTAAAGATTTCAACTAG
AGATTGGAGGTCAATAAAGTATACTTATTTTCTAATGGATAAGTAAAACCCAATGATAAA
CGATTTTCCACACTTCCAAATGATTTCTGCATAGTATTTGAACAGACTGCAAATATCATT
GAGTGCAATGAAGACATCCAAATTGAAGATTAAAAAGGAGAATTTGATAATACTCTTATT
GGGAGCATAGAGGAATGTGATGTTAACAAACCAATTGATGTTAGTGGAGTAATTATAGAA
ATGGCAGATCAAGAAATTGTTAAACTGAAAAATGGCTAACATAAATTAGTTTGTGAAATA
GACGATTAGGCAGAAGATAGTAATAGCTACTTGAACAGCTAAAAAATGAATCAAGAAGAG
ATTTTCTACTTCAATGGGTATATTTTGAAAACATACCCTGAAAAGATCATTTATAAAGCC
TGTATTTCAAATGATTGTAAAAGGAAAGTCGAATAGACTCAAGATGGCGTGTACTATTGT
GAGAAATGCAAGAAATGCTTTGATAATTATGCCCCAACTTACATGTTTTCTGTATATGAC
ATCAAAATAGTTTGA


>Contig9697.0.1.g33(protein)
MKLNKFLAKNIPYDTEYDIPQIPAIQEQVVQIQGDQEEEKMEKFCNAEDQHSQGSYQRDQ
DGSSGQHTALIQIPSPQKSVSNLQLESQYQSQFTQINRPLNFGQSQNQTQQYSQYQNRAQ
NYFQNRQERNSTIIDSKYMPIKALNTFSRDWQIQAKLARKSELRETQRQKTVVLKIEIID
VFGTTIECTFFADAAKDFNQRLEVNKVYLFSNGQVKPNDKRFSTLPNDFCIVFEQTANII
ECNEDIQIEDQKGEFDNTLIGSIEECDVNKPIDVSGVIIEMADQEIVKLKNGQHKLVCEI
DDQAEDSNSYLNSQKMNQEEIFYFNGYILKTYPEKIIYKACISNDCKRKVEQTQDGVYYC
EKCKKCFDNYAPTYMFSVYDIKIV